Paenibacillus sp. FSL P4-0081: P40081_19695 Help Entry P40081_19695      CDS       T03332                                  Name (GenBank) hypothetical protein   KO K02078   acyl carrier protein Organism paen  Paenibacillus sp. FSL P4-0081 Pathway paen00998   Biosynthesis of various antibiotics paen01100   Metabolic pathways paen01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:paen00001]  09100 Metabolism   09103 Lipid metabolism    00061 Fatty acid biosynthesis     P40081_19695    00074 Mycolic acid biosynthesis     P40081_19695   09110 Biosynthesis of other secondary metabolites    00998 Biosynthesis of various antibiotics     P40081_19695 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  PP-binding DUF7080 Motif Other DBs NCBI-ProteinID:  AIQ30129 LinkDB All DBs Position complement(4427493..4427762) Genome browser AA seq 89 aa AA seqDB search MEERISFAQFQGIFAEYLGIEASRLTPEVNLLLELGVDSLSLVNVMLRLEREYQVMFNPE DRVMTRTLGEAYELFDNYRSLVLDAQTGS NT seq 270 nt NT seq  +upstreamnt  +downstreamnt atggaagaacggataagctttgcacagttccagggaatctttgccgaatatttggggatt gaggcttcaagactgaccccggaggtcaatctgctgctggagctgggggtcgattcttta tctttggtcaatgtgatgcttaggctcgaaagagagtaccaggtcatgttcaatcccgaa gaccgggtaatgacccggacactgggcgaagcctatgagctgtttgacaactatagaagt ttggtccttgacgcgcagaccggcagttaa

DBGET integrated database retrieval system