Pseudomonas aeruginosa PAO581: M801_2936 Help Entry M801_2936         CDS       T03171                                  Symbol acpP Name (GenBank) acyl carrier protein   KO K02078   acyl carrier protein Organism paeo  Pseudomonas aeruginosa PAO581 Pathway paeo01100   Metabolic pathways paeo01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:paeo00001]  09100 Metabolism   09103 Lipid metabolism    00061 Fatty acid biosynthesis     M801_2936 (acpP)    00074 Mycolic acid biosynthesis     M801_2936 (acpP)   09110 Biosynthesis of other secondary metabolites    00998 Biosynthesis of various antibiotics     M801_2936 (acpP) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  PP-binding PP-binding_2 DUF7080 HLH DUF1896 TerB Ribosomal_L50 Motif Other DBs NCBI-ProteinID:  AGV62343 LinkDB All DBs Position complement(3104528..3104764) Genome browser AA seq 78 aa AA seqDB search MSTIEERVKKIVAEQLGVKEEEVTNSASFVEDLGADSLDTVELVMALEEEFETEIPDEKA EKITTVQEAIDYIVAHQQ NT seq 237 nt NT seq  +upstreamnt  +downstreamnt atgagcaccatcgaagaacgcgttaagaagatcgtcgctgaacaactcggcgtgaaggaa gaagaagtcaccaacagcgcttccttcgtcgaagacctgggcgccgactcccttgacacc gtcgagctggtgatggctctggaagaggaattcgagaccgaaatccctgacgagaaagct gaaaagatcaccaccgttcaggaagccatcgactacatcgttgctcaccagcaataa

DBGET integrated database retrieval system