Pseudomonas aeruginosa PAO581: M801_4396 Help Entry M801_4396         CDS       T03171                                  Symbol groS Name (GenBank) 10 kDa chaperonin   KO K04078   chaperonin GroES Organism paeo  Pseudomonas aeruginosa PAO581 Brite KEGG Orthology (KO) [BR:paeo00001]  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03110 Chaperones and folding catalysts [BR:paeo03110]     M801_4396 (groS)    03029 Mitochondrial biogenesis [BR:paeo03029]     M801_4396 (groS) Chaperones and folding catalysts [BR:paeo03110]  Heat shock proteins   HSP10    M801_4396 (groS) Mitochondrial biogenesis [BR:paeo03029]  Mitochondrial protein import machinery   Matrix    Other matrix factors     M801_4396 (groS) SSDB OrthologParalogGFIT Motif Pfam:  Cpn10 DUF7205 Motif Other DBs NCBI-ProteinID:  AGV59621 LinkDB All DBs Position complement(4696759..4697052) Genome browser AA seq 97 aa AA seqDB search MKLRPLHDRVVIRRSEEETKTAGGIVLPGSAAEKPNRGEVVAVGTGRVLDNGEVRALAVK VGDKVVFGPYSGSNAIKVDGEELLVMGESEILAVLED NT seq 294 nt NT seq  +upstreamnt  +downstreamnt atgaagcttcgtcctctgcatgatcgcgtcgttatccgtcgcagcgaggaagagaccaag accgcaggcggcatcgtgctgccgggttccgccgccgagaagccgaaccgcggtgaagtg gtagccgtaggtaccggtcgtgtactggacaacggcgaagtgcgcgctctggcagtgaag gtgggcgacaaggtggtcttcgggccttactccggcagcaacgccatcaaggtcgatggc gaggaactgctggtgatgggcgagtccgaaatcctcgccgtcctggaagactga

DBGET integrated database retrieval system