Pseudomonas aeruginosa PA1: PA1S_10565 Help Entry PA1S_10565        CDS       T02928                                  Name (GenBank) acyl carrier protein   KO K02078   acyl carrier protein Organism paep  Pseudomonas aeruginosa PA1 Pathway paep01100   Metabolic pathways paep01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:paep00001]  09100 Metabolism   09103 Lipid metabolism    00061 Fatty acid biosynthesis     PA1S_10565    00074 Mycolic acid biosynthesis     PA1S_10565   09110 Biosynthesis of other secondary metabolites    00998 Biosynthesis of various antibiotics     PA1S_10565 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  PP-binding PP-binding_2 ACP_SdgA_C HLH DUF1896 TerB Ribosomal_L50 Motif Other DBs NCBI-ProteinID:  AHA16767 LinkDB All DBs Position 2244142..2244378 Genome browser AA seq 78 aa AA seqDB search MSTIEERVKKIVAEQLGVKEEEVTNSASFVEDLGADSLDTVELVMALEEEFETEIPDEKA EKITTVQEAIDYIVAHQQ NT seq 237 nt NT seq  +upstreamnt  +downstreamnt atgagcaccatcgaagaacgcgttaagaagatcgtcgctgaacaactcggcgtgaaggaa gaagaagtcaccaacagcgcttccttcgtcgaagacctgggcgccgactcccttgacacc gtcgagctggtgatggctctggaagaggaattcgagaccgaaatccctgacgagaaagct gaaaagatcaccaccgttcaggaagccatcgactacatcgttgctcaccagcaataa

DBGET integrated database retrieval system