Pseudomonas aeruginosa PA1R: PA1R_gp0799 Help Entry PA1R_gp0799       CDS       T02929                                  Name (GenBank) Acyl carrier protein   KO K02078   acyl carrier protein Organism paer  Pseudomonas aeruginosa PA1R Pathway paer01100   Metabolic pathways paer01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:paer00001]  09100 Metabolism   09103 Lipid metabolism    00061 Fatty acid biosynthesis     PA1R_gp0799    00074 Mycolic acid biosynthesis     PA1R_gp0799   09110 Biosynthesis of other secondary metabolites    00998 Biosynthesis of various antibiotics     PA1R_gp0799 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  PP-binding PP-binding_2 DUF7080 HLH DUF1896 TerB Ribosomal_L50 Motif Other DBs NCBI-ProteinID:  AHA22566 LinkDB All DBs Position complement(914054..914290) Genome browser AA seq 78 aa AA seqDB search MSTIEERVKKIVAEQLGVKEEEVTNSASFVEDLGADSLDTVELVMALEEEFETEIPDEKA EKITTVQEAIDYIVAHQQ NT seq 237 nt NT seq  +upstreamnt  +downstreamnt atgagcaccatcgaagaacgcgttaagaagatcgtcgctgaacaactcggcgtgaaggaa gaagaagtcaccaacagcgcttccttcgtcgaagacctgggcgccgactcccttgacacc gtcgagctggtgatggctctggaagaggaattcgagaccgaaatccctgacgagaaagct gaaaagatcaccaccgttcaggaagccatcgactacatcgttgctcaccagcaataa

DBGET integrated database retrieval system