Pseudomonas aeruginosa PA1R: PA1R_gp2867 Help Entry PA1R_gp2867       CDS       T02929                                  Name (GenBank) RNA-binding protein Hfq   KO K03666   host factor-I protein Organism paer  Pseudomonas aeruginosa PA1R Pathway paer02024   Quorum sensing paer03018   RNA degradation Brite KEGG Orthology (KO) [BR:paer00001]  09120 Genetic Information Processing   09123 Folding, sorting and degradation    03018 RNA degradation     PA1R_gp2867  09140 Cellular Processes   09145 Cellular community - prokaryotes    02024 Quorum sensing     PA1R_gp2867  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03019 Messenger RNA biogenesis [BR:paer03019]     PA1R_gp2867    03036 Chromosome and associated proteins [BR:paer03036]     PA1R_gp2867 Messenger RNA biogenesis [BR:paer03019]  Prokaryotic type   Bacterial mRNA degradation factors    Other RNA degradation factors     Chaperones      PA1R_gp2867 Chromosome and associated proteins [BR:paer03036]  Prokaryotic type   Nucleoid associated proteins    Other nucleoid associated proteins     PA1R_gp2867 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Hfq LSM Hfq_1 Motif Other DBs NCBI-ProteinID:  AHA24593 LinkDB All DBs Position complement(3191920..3192168) Genome browser AA seq 82 aa AA seqDB search MSKGHSLQDPYLNTLRKERVPVSIYLVNGIKLQGQIESFDQFVILLKNTVSQMVYKHAIS TVVPSRPVRLPSGDQPAEPGNA NT seq 249 nt NT seq  +upstreamnt  +downstreamnt atgtcaaaagggcattcgctacaagacccttacctcaataccctgcggaaagaacgcgtc ccggtttccatctatctggtcaacggcatcaagctgcaaggccagatcgagtccttcgac cagtttgtcatcctgctgaagaacaccgtcagccagatggtttacaagcacgcgatctcc accgtggtaccgagccgtccggtgcgtctgccgagcggtgaccagccggccgagccgggc aacgcttga

DBGET integrated database retrieval system