Pseudomonas aeruginosa SCV20265: SCV20265_5006
Help
Entry
SCV20265_5006 CDS
T02971
Name
(GenBank) Ubiquinol-cytochrome C reductase iron-sulfur subunit
KO
K00411
ubiquinol-cytochrome c reductase iron-sulfur subunit [EC:
7.1.1.8
]
Organism
paes
Pseudomonas aeruginosa SCV20265
Pathway
paes00190
Oxidative phosphorylation
paes01100
Metabolic pathways
paes02020
Two-component system
paes04148
Efferocytosis
Module
paes_M00151
Cytochrome bc1 complex respiratory unit
Brite
KEGG Orthology (KO) [BR:
paes00001
]
09100 Metabolism
09102 Energy metabolism
00190 Oxidative phosphorylation
SCV20265_5006
09130 Environmental Information Processing
09132 Signal transduction
02020 Two-component system
SCV20265_5006
09140 Cellular Processes
09141 Transport and catabolism
04148 Efferocytosis
SCV20265_5006
Enzymes [BR:
paes01000
]
7. Translocases
7.1 Catalysing the translocation of protons
7.1.1 Linked to oxidoreductase reactions
7.1.1.8 quinol---cytochrome-c reductase
SCV20265_5006
BRITE hierarchy
SSDB
Ortholog
Paralog
Gene cluster
GFIT
Motif
Pfam:
Rieske
Motif
Other DBs
NCBI-ProteinID:
AHC79112
LinkDB
All DBs
Position
complement(5310597..5311043)
Genome browser
AA seq
148 aa
AA seq
DB search
MQVNVGKIDPGQQIIAEWRGKPVFIVHRTKEMLDALPSLEGQLADPDSKASEQPEYVDPK
LRSIKPELAVIVGICTHLGCSPTFRPEVAPADLGPDWKGGYFCPCHGSHYDLAGRVYKGQ
PAPLNLPIPPYTFDADDVITIGVDQEKA
NT seq
447 nt
NT seq
+upstream
nt +downstream
nt
gtgcaggtgaacgtgggcaagatcgatccaggtcagcagatcatcgctgaatggcgcggc
aagcctgtattcatcgtgcaccgcacgaaggagatgctggacgccctgccgagcctcgaa
ggacaactggccgacccggactccaaggcctcggagcagccggagtacgtcgatcccaag
cttcgctcgatcaagccggaactggcggtgatcgtcggcatctgcacccacttgggctgc
tcgccgaccttccgtcccgaagtcgcccccgccgacctcggtccggactggaagggcggc
tacttctgcccttgccacggttcccactacgacctcgccggtcgtgtctacaaaggccag
ccagcgccgctgaacctgccgattccgccttatacgttcgatgctgacgacgtcatcacc
atcggcgtggaccaggagaaagcctga
DBGET
integrated database retrieval system