KEGG   Pseudomonas aeruginosa SCV20265: SCV20265_5006
Entry
SCV20265_5006     CDS       T02971                                 
Name
(GenBank) Ubiquinol-cytochrome C reductase iron-sulfur subunit
  KO
K00411  ubiquinol-cytochrome c reductase iron-sulfur subunit [EC:7.1.1.8]
Organism
paes  Pseudomonas aeruginosa SCV20265
Pathway
paes00190  Oxidative phosphorylation
paes01100  Metabolic pathways
paes02020  Two-component system
paes04148  Efferocytosis
Module
paes_M00151  Cytochrome bc1 complex respiratory unit
Brite
KEGG Orthology (KO) [BR:paes00001]
 09100 Metabolism
  09102 Energy metabolism
   00190 Oxidative phosphorylation
    SCV20265_5006
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    SCV20265_5006
 09140 Cellular Processes
  09141 Transport and catabolism
   04148 Efferocytosis
    SCV20265_5006
Enzymes [BR:paes01000]
 7. Translocases
  7.1  Catalysing the translocation of protons
   7.1.1  Linked to oxidoreductase reactions
    7.1.1.8  quinol---cytochrome-c reductase
     SCV20265_5006
SSDB
Motif
Pfam: Rieske
Other DBs
NCBI-ProteinID: AHC79112
LinkDB
Position
complement(5310597..5311043)
AA seq 148 aa
MQVNVGKIDPGQQIIAEWRGKPVFIVHRTKEMLDALPSLEGQLADPDSKASEQPEYVDPK
LRSIKPELAVIVGICTHLGCSPTFRPEVAPADLGPDWKGGYFCPCHGSHYDLAGRVYKGQ
PAPLNLPIPPYTFDADDVITIGVDQEKA
NT seq 447 nt   +upstreamnt  +downstreamnt
gtgcaggtgaacgtgggcaagatcgatccaggtcagcagatcatcgctgaatggcgcggc
aagcctgtattcatcgtgcaccgcacgaaggagatgctggacgccctgccgagcctcgaa
ggacaactggccgacccggactccaaggcctcggagcagccggagtacgtcgatcccaag
cttcgctcgatcaagccggaactggcggtgatcgtcggcatctgcacccacttgggctgc
tcgccgaccttccgtcccgaagtcgcccccgccgacctcggtccggactggaagggcggc
tacttctgcccttgccacggttcccactacgacctcgccggtcgtgtctacaaaggccag
ccagcgccgctgaacctgccgattccgccttatacgttcgatgctgacgacgtcatcacc
atcggcgtggaccaggagaaagcctga

DBGET integrated database retrieval system