Pseudomonas aeruginosa SCV20265: SCV20265_5512 Help Entry SCV20265_5512     CDS       T02971                                  Name (GenBank) DNA-binding protein Fis   KO K03557   Fis family transcriptional regulator, factor for inversion stimulation protein Organism paes  Pseudomonas aeruginosa SCV20265 Brite KEGG Orthology (KO) [BR:paes00001]  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03000 Transcription factors [BR:paes03000]     SCV20265_5512    03036 Chromosome and associated proteins [BR:paes03036]     SCV20265_5512    03400 DNA repair and recombination proteins [BR:paes03400]     SCV20265_5512 Transcription factors [BR:paes03000]  Prokaryotic type   Helix-turn-helix    Other families     SCV20265_5512 Chromosome and associated proteins [BR:paes03036]  Prokaryotic type   Nucleoid associated proteins    Other nucleoid associated proteins     SCV20265_5512 DNA repair and recombination proteins [BR:paes03400]  Prokaryotic type   DSBR (double strand breaks repair)    NHEJ (non-homologous end-joining)     SHDIR (short-homology-dependent illegitimate recombination)      Facilitator       SCV20265_5512 SSDB OrthologParalogGFIT Motif Pfam:  Fis_N HTH_8 Xre-like-HTH HTH_30 RBD Motif Other DBs NCBI-ProteinID:  AHC79618 LinkDB All DBs Position 5861775..5862053 Genome browser AA seq 92 aa AA seqDB search MSDNANLKQHLTTPTQEGQTLRDSVEKALHNYFAHLEGQPVTDVYNMVLCEVEAPLLETV MNHVKGNQTKASELLGLNRGTLRKKLKQYDLL NT seq 279 nt NT seq  +upstreamnt  +downstreamnt gtgagcgacaacgccaacctgaaacagcacctcaccacgccgacgcaagaagggcagacc ctgcgcgacagcgtggagaaggcattgcacaactacttcgcccacctcgaagggcagccg gtcacggacgtttacaacatggtgctctgcgaagtcgaagcgccgctgctggaaaccgtc atgaaccacgtcaaggggaaccagaccaaggcctccgagctactcggcctgaaccgcggg accctgcgcaagaaactcaagcaatacgatcttctttaa

DBGET integrated database retrieval system