Pseudomonas aeruginosa PA38182: BN889_02889
Help
Entry
BN889_02889 CDS
T03031
Symbol
clpS
Name
(GenBank) ATP-dependent Clp protease adaptor protein ClpS
KO
K06891
ATP-dependent Clp protease adaptor protein ClpS
Organism
paeu
Pseudomonas aeruginosa PA38182
Brite
KEGG Orthology (KO) [BR:
paeu00001
]
09190 Not Included in Pathway or Brite
09192 Unclassified: genetic information processing
99975 Protein processing
BN889_02889 (clpS)
BRITE hierarchy
SSDB
Ortholog
Paralog
Gene cluster
GFIT
Motif
Pfam:
ClpS
Motif
Other DBs
NCBI-ProteinID:
CDI90944
LinkDB
All DBs
Position
complement(3060662..3061030)
Genome browser
AA seq
122 aa
AA seq
DB search
MHAPSQIRLTFNQDHPEPHEHEDEGAGLAVQESKPVLQPPPLYKVVLFNDDYTPMDFVVE
VLEVFFNMDREKATKIMLTVHTQGKAVCGLFTRDVAETKAMQVNQYARESQHPLLCEIEK
DS
NT seq
369 nt
NT seq
+upstream
nt +downstream
nt
atgcatgcacctagccagattcgactaacattcaatcaggaccatcccgagcctcatgag
cacgaggacgaaggggcggggctcgcggtacaggagtcgaagcctgtattacagccgcca
ccgttgtataaggtggtactgttcaacgacgattacacgccgatggactttgttgttgaa
gtgctggaagtgttcttcaacatggaccgggaaaaagccaccaagatcatgttgacggta
catactcagggtaaggcggtctgcggcttgtttacccgggacgtggccgaaaccaaggcg
atgcaggtcaatcagtatgcacgggagagccagcatccattgctctgcgagatagagaaa
gacagttga
DBGET
integrated database retrieval system