Paraneptunicella aestuarii: KIH87_03940 Help Entry KIH87_03940       CDS       T07748                                  Symbol acpP Name (GenBank) acyl carrier protein   KO K02078   acyl carrier protein Organism paew  Paraneptunicella aestuarii Pathway paew00998   Biosynthesis of various antibiotics paew01100   Metabolic pathways paew01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:paew00001]  09100 Metabolism   09103 Lipid metabolism    00061 Fatty acid biosynthesis     KIH87_03940 (acpP)    00074 Mycolic acid biosynthesis     KIH87_03940 (acpP)   09110 Biosynthesis of other secondary metabolites    00998 Biosynthesis of various antibiotics     KIH87_03940 (acpP) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  PP-binding DUF7080 PP-binding_2 PRMT_C DUF1493 Motif Other DBs NCBI-ProteinID:  UAA39517 LinkDB All DBs Position complement(951190..951444) Genome browser AA seq 84 aa AA seqDB search MINIDEKVKKIIAEQLNVKQEQVTDDSKLVESLDLDSLDVVELTLKFEEAFDIDIYEEAL PQMKVVGDVIRYIEVNYDPELAEI NT seq 255 nt NT seq  +upstreamnt  +downstreamnt atgattaatatcgacgaaaaagttaaaaaaatcattgccgaacaactcaatgtcaaacag gaacaagttaccgatgactctaaattggtcgagtctcttgatttagatagccttgacgta gtggagctaacgcttaagtttgaagaagctttcgatatcgatatttatgaagaagctttg cctcaaatgaaagttgtaggtgatgtaatacgctacatagaagttaattacgatccagaa cttgctgaaatttag

DBGET integrated database retrieval system