Paraneptunicella aestuarii: KIH87_06175
Help
Entry
KIH87_06175 CDS
T07748
Symbol
rodA
Name
(GenBank) rod shape-determining protein RodA
KO
K05837
peptidoglycan glycosyltransferase [EC:
2.4.99.28
]
Organism
paew
Paraneptunicella aestuarii
Pathway
paew00550
Peptidoglycan biosynthesis
Brite
KEGG Orthology (KO) [BR:
paew00001
]
09100 Metabolism
09107 Glycan biosynthesis and metabolism
00550 Peptidoglycan biosynthesis
KIH87_06175 (rodA)
09180 Brite Hierarchies
09181 Protein families: metabolism
01003 Glycosyltransferases [BR:
paew01003
]
KIH87_06175 (rodA)
01011 Peptidoglycan biosynthesis and degradation proteins [BR:
paew01011
]
KIH87_06175 (rodA)
09182 Protein families: genetic information processing
03036 Chromosome and associated proteins [BR:
paew03036
]
KIH87_06175 (rodA)
Enzymes [BR:
paew01000
]
2. Transferases
2.4 Glycosyltransferases
2.4.99 Transferring other glycosyl groups
2.4.99.28 peptidoglycan glycosyltransferase
KIH87_06175 (rodA)
Glycosyltransferases [BR:
paew01003
]
Polysaccharide
Bacterial polysaccharide (excluding LPS)
KIH87_06175 (rodA)
Peptidoglycan biosynthesis and degradation proteins [BR:
paew01011
]
Peptidoglycan biosynthesis and degradation
Glycosyltransferase
KIH87_06175 (rodA)
Chromosome and associated proteins [BR:
paew03036
]
Prokaryotic type
Chromosome partitioning proteins
Other chromosome partitioning proteins
KIH87_06175 (rodA)
BRITE hierarchy
SSDB
Ortholog
Paralog
Gene cluster
GFIT
Motif
Pfam:
FTSW_RODA_SPOVE
Motif
Other DBs
NCBI-ProteinID:
UAA39937
LinkDB
All DBs
Position
complement(1450023..1451141)
Genome browser
AA seq
372 aa
AA seq
DB search
MVRNKLDPNKTTFLAKIHLDAPLLLALLTLMAVGLFTIYSAGGQDLVLVKKQVVRLGVAF
SAMVLVAQIPPLAYRRLSIYFYVIGVLMLVAVLAIGVSGKGAQRWLDLGFFRFQPSEIMK
LAVPMMVAWYISRANLPPRTSQVAIAFLIVITPTLLIAKQPDLGTSLLIASSGIFAIFLA
GLRWKLMSFLAAAGLIFAPILWMFLMKDYQKQRVLTFLNPESDPLGSGYHIIQSKIAIGS
GGMEGKGWLQGTQSQLEFLPERHTDFIFSVFSEEFGFVGVSALMALYGFIVIRGMIIAIR
AQEAYSKLLAGSITLTFFVYVFVNMGMVSGILPVVGVPLPLVSYGGTSMVTILTGFGILM
AIATQKRFMSRE
NT seq
1119 nt
NT seq
+upstream
nt +downstream
nt
atggtgcggaataaactcgatccgaacaaaaccacatttcttgccaagatccatcttgat
gcgcccttattgctggcactattaaccttgatggcggttggcctgtttaccatttattca
gcaggcgggcaggatctggttttagtgaaaaaacaggttgtacgtttaggcgtggccttc
tcggcaatggtactggttgctcaaatcccaccgttagcctatcgacgattatccatttat
ttctatgttatcggcgtactcatgttggtagcggtgcttgccattggcgtatcgggaaaa
ggcgcccaacgctggctggatttaggcttcttccgctttcagccctctgaaatcatgaag
cttgcggttcccatgatggtggcttggtatatcagccgagctaacctgccgccacgtacc
agccaggttgccattgcatttcttatcgtaatcacgccaaccttgctgatcgccaagcag
cccgacttgggtacgtcgttgcttattgccagttcagggatatttgccatctttttagca
ggcttgcgttggaaactcatgagctttctcgcggctgccgggctgatattcgcgccgata
ttatggatgtttttaatgaaggattatcaaaaacagcgcgtactcacttttctaaatccg
gaaagcgatcctctgggctcgggttaccatattattcaatccaaaattgccatcggctct
ggcggcatggaaggtaaaggctggctgcaaggtactcaatcacaattggaattcctgccg
gaacgccacactgattttattttctcggtattcagtgaagagtttggttttgttggcgtt
agcgcactaatggccttatatggtttcatcgtgatacgcggcatgatcatcgccatccgt
gcgcaggaagcctacagtaaactgctggctggcagcatcaccctcaccttttttgtgtat
gtcttcgtcaacatgggcatggtttctggaatacttcccgtcgtgggcgtaccgctgcct
cttgtgagttatggtggaacctcgatggtgacaatactcacaggttttggcattcttatg
gcgatcgcaacgcaaaaacgtttcatgtctcgtgaataa
DBGET
integrated database retrieval system