Paraneptunicella aestuarii: KIH87_19205 Help Entry KIH87_19205       CDS       T07748                                  Symbol grxC Name (GenBank) glutaredoxin 3   KO K03676   glutaredoxin 3 Organism paew  Paraneptunicella aestuarii Brite KEGG Orthology (KO) [BR:paew00001]  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03110 Chaperones and folding catalysts [BR:paew03110]     KIH87_19205 (grxC) Chaperones and folding catalysts [BR:paew03110]  Protein folding catalysts   Protein disulfide isomerase    KIH87_19205 (grxC) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Glutaredoxin GST_N_2 GST_N_3 Glrx-like Thioredoxin_3 SH3BGR Thioredoxin_2 Motif Other DBs NCBI-ProteinID:  UAA38759 LinkDB All DBs Position 4865448..4865708 Genome browser AA seq 86 aa AA seqDB search MKKVEIYTKGHCPYCKRAKALLDSKNVAYIEYKIDEQPELRDGMIERANGGYTVPQIFIG GDLHIGGCDDMMALEEQQKLDPLLAD NT seq 261 nt NT seq  +upstreamnt  +downstreamnt atgaaaaaagtagagatatacaccaagggtcattgcccatactgcaaaagagccaaagcc cttttagacagtaaaaatgtggcatacatagagtacaaaattgacgagcagccagaatta cgtgacggcatgattgaaagagcaaatggtggctacaccgttcctcaaattttcattggt ggcgatctgcacattggcggctgcgacgatatgatggcgcttgaagaacaacaaaagtta gatccacttctagccgactag

DBGET integrated database retrieval system