Paracoccus aestuarii: JHW48_02490 Help Entry JHW48_02490       CDS       T08926                                  Name (GenBank) acyl carrier protein   KO K02078   acyl carrier protein Organism paex  Paracoccus aestuarii Pathway paex01100   Metabolic pathways paex01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:paex00001]  09100 Metabolism   09103 Lipid metabolism    00061 Fatty acid biosynthesis     JHW48_02490    00074 Mycolic acid biosynthesis     JHW48_02490   09110 Biosynthesis of other secondary metabolites    00998 Biosynthesis of various antibiotics     JHW48_02490 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  PP-binding PP-binding_2 DUF7080 Ribosomal_L12_N Ribosomal_L50 Motif Other DBs NCBI-ProteinID:  WCQ99633 LinkDB All DBs Position 495038..495271 Genome browser AA seq 77 aa AA seqDB search MSDIADRVKKIVVEHLGVDEDKVVESASFIDDLGADSLDTVELVMAFEEEFGIEIPDDAA ETIQTVGDAVNFIKGAV NT seq 234 nt NT seq  +upstreamnt  +downstreamnt atgagcgatatcgctgatcgcgtgaagaagatcgtggtcgagcatctgggtgtcgacgag gacaaggtggtcgaatccgcttcgttcatcgacgatctgggtgccgacagcctcgacacc gtcgagctggtgatggccttcgaggaagagttcgggatcgagatccccgacgacgccgcc gagaccatccagaccgtcggcgacgcggtgaacttcatcaagggcgcggtctga

DBGET integrated database retrieval system