Paeniglutamicibacter sp. Y32M11: KUF55_09980 Help Entry KUF55_09980       CDS       T07362                                  Name (GenBank) acyl carrier protein   KO K02078   acyl carrier protein Organism paey  Paeniglutamicibacter sp. Y32M11 Pathway paey00998   Biosynthesis of various antibiotics paey01100   Metabolic pathways paey01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:paey00001]  09100 Metabolism   09103 Lipid metabolism    00061 Fatty acid biosynthesis     KUF55_09980    00074 Mycolic acid biosynthesis     KUF55_09980   09110 Biosynthesis of other secondary metabolites    00998 Biosynthesis of various antibiotics     KUF55_09980 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  PP-binding PP-binding_2 Ribosomal_L50 Pro_sub2 Ag332 Motif Other DBs NCBI-ProteinID:  QXQ08864 LinkDB All DBs Position 2264776..2265021 Genome browser AA seq 81 aa AA seqDB search MASNEEILAGLAEIVNEETGLETEAVEMDKSFTEDLDIDSISMMTIVVNAEEKFDVKIPD EEVKNLKTVADAVNFIAAAQA NT seq 246 nt NT seq  +upstreamnt  +downstreamnt atggctagcaacgaagagattctggccggcttggccgagatcgtcaacgaagagaccggt ctggagaccgaagctgttgaaatggacaagtccttcaccgaggatctggacatcgactcc atctcgatgatgaccatcgtcgtcaacgccgaagaaaagttcgacgtgaagatcccggac gaagaggtcaagaaccttaagaccgttgcagatgcagtgaacttcatcgctgctgcacag gcctaa

DBGET integrated database retrieval system