Pseudomonas aeruginosa LESB58: PLES_17301 Help Entry PLES_17301        CDS       T00818                                  Name (GenBank) probable acyl carrier protein   KO K02078   acyl carrier protein Organism pag  Pseudomonas aeruginosa LESB58 Pathway pag01100   Metabolic pathways pag01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:pag00001]  09100 Metabolism   09103 Lipid metabolism    00061 Fatty acid biosynthesis     PLES_17301    00074 Mycolic acid biosynthesis     PLES_17301   09110 Biosynthesis of other secondary metabolites    00998 Biosynthesis of various antibiotics     PLES_17301 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  PP-binding DUF7080 Motif Other DBs NCBI-ProteinID:  CAW26458 LinkDB All DBs Position complement(1858903..1859142) Genome browser AA seq 79 aa AA seqDB search MPNDMEDHLLTVLSVASGVPKEEISRDSRMEDLAFDSLVVSELSLKLRKEFGVTGVDDEL DLLETVDELFQLVEKHRAA NT seq 240 nt NT seq  +upstreamnt  +downstreamnt atgcccaacgacatggaagaccatctcctcaccgtgctcagcgtcgccagcggcgtgccg aaggaggaaatcagccgggacagcaggatggaagacctggctttcgattcgctggtggtc agcgagctgtcgctgaagctgcgcaaggagttcggcgtcaccggggtcgacgacgaactc gacctgctggaaacggtggacgaactgttccagctggtcgagaagcaccgcgccgcctga

DBGET integrated database retrieval system