Pseudomonas aeruginosa LESB58: PLES_47651 Help Entry PLES_47651        CDS       T00818                                  Symbol groES Name (GenBank) GroES protein   KO K04078   chaperonin GroES Organism pag  Pseudomonas aeruginosa LESB58 Brite KEGG Orthology (KO) [BR:pag00001]  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03110 Chaperones and folding catalysts [BR:pag03110]     PLES_47651 (groES)    03029 Mitochondrial biogenesis [BR:pag03029]     PLES_47651 (groES) Chaperones and folding catalysts [BR:pag03110]  Heat shock proteins   HSP10    PLES_47651 (groES) Mitochondrial biogenesis [BR:pag03029]  Mitochondrial protein import machinery   Matrix    Other matrix factors     PLES_47651 (groES) SSDB OrthologParalogGFIT Motif Pfam:  Cpn10 DUF7205 Motif Other DBs NCBI-ProteinID:  CAW29519 UniProt:  B7UZG4 LinkDB All DBs Position complement(5250882..5251175) Genome browser AA seq 97 aa AA seqDB search MKLRPLHDRVVIRRSEEETKTAGGIVLPGSAAEKPNRGEVVAVGTGRVLDNGEVRALAVK VGDKVVFGPYSGSNAIKVDGEELLVMGESEILAVLED NT seq 294 nt NT seq  +upstreamnt  +downstreamnt atgaagcttcgtcctctgcatgatcgcgtcgttatccgtcgcagcgaggaagagaccaag accgcaggcggcatcgtgctgccgggttccgccgccgagaagccgaaccgcggtgaagtg gtagccgtaggtaccggtcgtgtactggacaacggcgaagtgcgcgctctggcagtgaag gtgggcgacaaggtggtcttcgggccttactccggcagcaacgccatcaaggtcgatggc gaggaactgctggtgatgggcgagtccgaaatcctcgccgtcctggaagactga

DBGET integrated database retrieval system