Pseudomonas agarici: AWM79_03890 Help Entry AWM79_03890       CDS       T11104                                  Name (GenBank) acyl carrier protein   KO K02078   acyl carrier protein Organism pagb  Pseudomonas agarici Pathway pagb01100   Metabolic pathways pagb01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:pagb00001]  09100 Metabolism   09103 Lipid metabolism    00061 Fatty acid biosynthesis     AWM79_03890    00074 Mycolic acid biosynthesis     AWM79_03890   09110 Biosynthesis of other secondary metabolites    00998 Biosynthesis of various antibiotics     AWM79_03890 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  MMR_HSR1 DUF2496 Motif Other DBs NCBI-ProteinID:  AMB84496 UniProt:  A0A0X1SXA1 LinkDB All DBs Position complement(855776..856033) Genome browser AA seq 85 aa AA seqDB search MENRLNRDKITEKVIQLFVDTIGFLEREQVTEQTDFIRDFKIIDDDLTCFVMQVEWQFKL HSSQEDRNAITTIRQIVDLITHPSD NT seq 258 nt NT seq  +upstreamnt  +downstreamnt atggaaaatagactgaatcgagataaaatcaccgaaaaggttatccaactgtttgtcgac accatcggttttctcgaacgagagcaggtgacggagcaaaccgacttcattcgcgacttc aagatcattgacgatgaccttacctgcttcgtgatgcaggtggaatggcagttcaaattg cattcatcccaggaagaccggaacgccattaccacaatcaggcaaatcgtcgacctcatc acccacccatccgactga

DBGET integrated database retrieval system