Pseudomonas agarici: AWM79_08365 Help Entry AWM79_08365       CDS       T11104                                  Name (GenBank) histidine kinase   KO K20976   histidine phosphotransfer protein HptB Organism pagb  Pseudomonas agarici Pathway pagb02020   Two-component system pagb02025   Biofilm formation - Pseudomonas aeruginosa Brite KEGG Orthology (KO) [BR:pagb00001]  09130 Environmental Information Processing   09132 Signal transduction    02020 Two-component system     AWM79_08365  09140 Cellular Processes   09145 Cellular community - prokaryotes    02025 Biofilm formation - Pseudomonas aeruginosa     AWM79_08365  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    02022 Two-component system [BR:pagb02022]     AWM79_08365 Two-component system [BR:pagb02022]  Other families   SagS-HptB-HsbR (swarming activity and biofilm formation)    AWM79_08365 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Hpt Motif Other DBs NCBI-ProteinID:  AMB88259 UniProt:  A0A0X1T8Y6 LinkDB All DBs Position complement(1904341..1904640) Genome browser AA seq 99 aa AA seqDB search MEDEYPLLLDTFLNDSEKRLGQLHQASNALELGRAAHSFKGSSSNMGALYLADLCRQLEE RAARLPLTGIEDLVGRIDREYEQVRHLFARERERFPVKH NT seq 300 nt NT seq  +upstreamnt  +downstreamnt atggaagatgagtatccactgttgctggatacttttctcaacgattcggaaaaacgcctg gggcagttacatcaggccagcaacgcgctggagcttgggcgggcagcccacagtttcaag ggcagcagcagcaatatgggggctttgtacttggccgatctttgccggcaactggaagag cgggccgcacggttgccgctgacggggatcgaagatctggtcgggcggatcgatcgcgag tacgaacaggtacgccatttgttcgcgcgcgagcgtgagcgtttcccggtcaagcattaa

DBGET integrated database retrieval system