Pantoea agglomerans C410P1: BEE12_13940 Help Entry BEE12_13940       CDS       T04739                                  Name (GenBank) acyl carrier protein   KO K02078   acyl carrier protein Organism pagc  Pantoea agglomerans C410P1 Pathway pagc00998   Biosynthesis of various antibiotics pagc01100   Metabolic pathways pagc01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:pagc00001]  09100 Metabolism   09103 Lipid metabolism    00061 Fatty acid biosynthesis     BEE12_13940    00074 Mycolic acid biosynthesis     BEE12_13940   09110 Biosynthesis of other secondary metabolites    00998 Biosynthesis of various antibiotics     BEE12_13940 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  PP-binding Motif Other DBs NCBI-ProteinID:  AOE40855 UniProt:  A0A356RVB0 LinkDB All DBs Position 3054931..3055185 Genome browser AA seq 84 aa AA seqDB search MMNKEQIYQEVASLLTSLFEIAPEDIHPEARLYEDLELDSIDAVDMVVHLQKRTGRKIKP ETFRAVRTVQDVVDAVEQLMREDA NT seq 255 nt NT seq  +upstreamnt  +downstreamnt atgatgaacaaagaacagatctatcaggaagtagcttcgctgctgaccagcctgtttgaa attgcgcctgaggatatccatcccgaggcacgtctgtatgaagatctcgaactcgacagc attgacgccgtcgatatggtggttcatctgcaaaaacgtaccggccgtaagattaaaccg gaaactttccgcgcagtgcgcaccgtgcaggatgtggtggatgccgtggaacaactgatg cgcgaagacgcctga

DBGET integrated database retrieval system