Pantoea vagans FDAARGOS_160: AL522_11520 Help Entry AL522_11520       CDS       T04302                                  Name (GenBank) acyl carrier protein   KO K02078   acyl carrier protein Organism pagg  Pantoea vagans FDAARGOS_160 Pathway pagg01100   Metabolic pathways pagg01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:pagg00001]  09100 Metabolism   09103 Lipid metabolism    00061 Fatty acid biosynthesis     AL522_11520    00074 Mycolic acid biosynthesis     AL522_11520   09110 Biosynthesis of other secondary metabolites    00998 Biosynthesis of various antibiotics     AL522_11520 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  PP-binding Motif Other DBs NCBI-ProteinID:  AMG58210 LinkDB All DBs Position 1708206..1708463 Genome browser AA seq 85 aa AA seqDB search MDSLINDIKQMIIDTLNLEDLRPDDIETDAALFGDGLGLDSIDALELGLAVKNCYGVALS AESETLRAHFFSVATLAAFVNQQRG NT seq 258 nt NT seq  +upstreamnt  +downstreamnt atggattcattaattaacgatatcaaacagatgattatcgacacgctgaaccttgaagac cttagacccgatgatatagagaccgacgcggcgctgtttggcgacggactggggctggac tccattgatgcactggaacttggcctggcagtgaaaaattgctatggcgtggcactttct gcggagagtgaaaccctgcgtgcccacttcttctctgttgcgacgctggcagcgttcgtc aaccaacagcgcggctga

DBGET integrated database retrieval system