Pantoea vagans FDAARGOS_160: AL522_11820 Help Entry AL522_11820       CDS       T04302                                  Name (GenBank) acyl carrier protein   KO K02078   acyl carrier protein Organism pagg  Pantoea vagans FDAARGOS_160 Pathway pagg01100   Metabolic pathways pagg01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:pagg00001]  09100 Metabolism   09103 Lipid metabolism    00061 Fatty acid biosynthesis     AL522_11820    00074 Mycolic acid biosynthesis     AL522_11820   09110 Biosynthesis of other secondary metabolites    00998 Biosynthesis of various antibiotics     AL522_11820 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  PP-binding PP-binding_2 DUF7080 TerB DUF1896 HLH Ribosomal_L50 DUF1493 Motif Other DBs NCBI-ProteinID:  AMG58266 UniProt:  A0AAN1NQH0 LinkDB All DBs Position 1765996..1766232 Genome browser AA seq 78 aa AA seqDB search MSDIEQRVKKIISEQLGVKEEEVTNSASFVEDLGADSLDTVELVMALEEEFDTEIPDEEA EKITTVQAAIDYINSHKG NT seq 237 nt NT seq  +upstreamnt  +downstreamnt atgagcgatatcgaacaacgcgttaagaaaatcatcagtgagcagctgggtgtgaaagag gaagaagtcaccaactctgcatctttcgtagaagacctgggtgccgattctcttgatacc gttgagctggtgatggctctggaagaagagtttgatactgagattccagacgaagaagct gagaaaatcactaccgttcaggcagcgatcgactacatcaatagccataaaggctaa

DBGET integrated database retrieval system