Planktothrix agardhii: NIES204_08490 Help Entry NIES204_08490     CDS       T05658                                  Name (GenBank) acyl carrier protein   KO K02078   acyl carrier protein Organism pagh  Planktothrix agardhii Pathway pagh00998   Biosynthesis of various antibiotics pagh01100   Metabolic pathways pagh01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:pagh00001]  09100 Metabolism   09103 Lipid metabolism    00061 Fatty acid biosynthesis     NIES204_08490    00074 Mycolic acid biosynthesis     NIES204_08490   09110 Biosynthesis of other secondary metabolites    00998 Biosynthesis of various antibiotics     NIES204_08490 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  PP-binding PP-binding_2 ACP_SdgA_C Ribosomal_L12_N Ribosomal_L50 TRI4_N Motif Other DBs NCBI-ProteinID:  BBD53575 LinkDB All DBs Position 1001954..1002199 Genome browser AA seq 81 aa AA seqDB search MSDTFDRVKKIVEEQLDVEPDKILPSASFTDDLGADSLDIVELVMALEEEFEIEIPDEAA EKILTVQEVVDYIKDKVPASA NT seq 246 nt NT seq  +upstreamnt  +downstreamnt atgagtgatacgtttgacagagtgaagaaaattgttgaagaacaattagatgttgaacca gacaaaatcctaccatcagcaagctttaccgatgatttaggcgctgattctctggatata gtggaactggtgatggcgttagaagaagaatttgaaatcgaaattcctgatgaagcagct gaaaaaattctgacagttcaagaggttgtagactacatcaaagacaaggtaccagcatca gcttaa

DBGET integrated database retrieval system