Paenarthrobacter sp. GOM3: IRJ34_18595 Help Entry IRJ34_18595       CDS       T10366                                  Name (GenBank) HU family DNA-binding protein   KO K03530   DNA-binding protein HU-beta Organism pago  Paenarthrobacter sp. GOM3 Brite KEGG Orthology (KO) [BR:pago00001]  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03032 DNA replication proteins [BR:pago03032]     IRJ34_18595    03036 Chromosome and associated proteins [BR:pago03036]     IRJ34_18595    03400 DNA repair and recombination proteins [BR:pago03400]     IRJ34_18595 DNA replication proteins [BR:pago03032]  Prokaryotic type   DNA Replication Initiation Factors    Initiation factors (bacterial)     IRJ34_18595 Chromosome and associated proteins [BR:pago03036]  Prokaryotic type   Nucleoid associated proteins    HU (heat unstable protein)     IRJ34_18595 DNA repair and recombination proteins [BR:pago03400]  Prokaryotic type   DSBR (double strand breaks repair)    NHEJ (non-homologous end-joining)     SHIIR (short-homology-independent illegitimate recombination)      Supressor       IRJ34_18595 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Bac_DNA_binding HU-HIG Motif Other DBs NCBI-ProteinID:  WOH18339 LinkDB All DBs Position complement(4013652..4013939) Genome browser AA seq 95 aa AA seqDB search MAKNRSELVAEVAGKAGTSQAAVNSVLDALFEVFETSVAAGEKITIPGWLAVERTDRAAR TGRNPQTGETIQIAAGHSVKLTAGSKLKAAVAKKK NT seq 288 nt NT seq  +upstreamnt  +downstreamnt atggctaagaaccgtagtgaactcgttgcagaggtagcaggcaaggctggcaccagccag gcagcagtcaactccgtgctcgatgcactgttcgaagttttcgagacttctgtcgccgct ggcgaaaagatcaccatcccgggctggctcgcagttgagcgcaccgaccgtgcagctcgc accggccgcaacccgcagaccggcgaaaccatccagatcgcagccggccacagcgtcaag ctgaccgcaggctccaagctgaaggctgctgtcgccaagaagaagtaa

DBGET integrated database retrieval system