Paenibacillus sp. IHB B 3084: ASL14_11660 Help Entry ASL14_11660       CDS       T05348                                  Name (GenBank) DNA-binding protein   KO K03530   DNA-binding protein HU-beta Organism paih  Paenibacillus sp. IHB B 3084 Brite KEGG Orthology (KO) [BR:paih00001]  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03032 DNA replication proteins [BR:paih03032]     ASL14_11660    03036 Chromosome and associated proteins [BR:paih03036]     ASL14_11660    03400 DNA repair and recombination proteins [BR:paih03400]     ASL14_11660 DNA replication proteins [BR:paih03032]  Prokaryotic type   DNA Replication Initiation Factors    Initiation factors (bacterial)     ASL14_11660 Chromosome and associated proteins [BR:paih03036]  Prokaryotic type   Nucleoid associated proteins    HU (heat unstable protein)     ASL14_11660 DNA repair and recombination proteins [BR:paih03400]  Prokaryotic type   DSBR (double strand breaks repair)    NHEJ (non-homologous end-joining)     SHIIR (short-homology-independent illegitimate recombination)      Supressor       ASL14_11660 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Bac_DNA_binding HU-HIG HU-CCDC81_euk_2 HU-CCDC81_bac_2 Motif Other DBs NCBI-ProteinID:  ALP36717 UniProt:  A0A0S2S4S5 LinkDB All DBs Position complement(2555404..2555676) Genome browser AA seq 90 aa AA seqDB search MNKTDLINNISSKSGLSKRDVEAVLNGVLGEITDALASGDKVQLIGFGTFETRKRSSRTG RNPQTGNTIEIPESTVPAFKAGNKLKEAVN NT seq 273 nt NT seq  +upstreamnt  +downstreamnt atgaacaagacagatctgatcaacaatatttccagcaaaagcggtttgagcaaacgtgac gttgaagctgtattgaatggcgttcttggtgaaattacagatgcactcgccagcggtgac aaagtgcaactgatcggctttggtactttcgaaacgcgcaagcgttccagccgtacaggc cgcaatccacaaaccggtaacacgattgagattccagaatcgaccgttcctgcttttaaa gccggtaataagcttaaagaagccgttaactaa

DBGET integrated database retrieval system