Pantoea ananatis AJ13355: PAJ_0503 Help Entry PAJ_0503          CDS       T01969                                  Symbol ybgT Name (GenBank) hypothetical protein YbgT   KO K00424   cytochrome bd-I ubiquinol oxidase subunit X [EC:7.1.1.7] Organism paj  Pantoea ananatis AJ13355 Pathway paj00190   Oxidative phosphorylation paj01100   Metabolic pathways paj02020   Two-component system Module paj_M00153   Cytochrome bd ubiquinol oxidase Brite KEGG Orthology (KO) [BR:paj00001]  09100 Metabolism   09102 Energy metabolism    00190 Oxidative phosphorylation     PAJ_0503 (ybgT)  09130 Environmental Information Processing   09132 Signal transduction    02020 Two-component system     PAJ_0503 (ybgT) Enzymes [BR:paj01000]  7. Translocases   7.1  Catalysing the translocation of protons    7.1.1  Linked to oxidoreductase reactions     7.1.1.7  quinol oxidase (electrogenic, proton-motive force generating)      PAJ_0503 (ybgT) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  YbgT_YccB Motif Other DBs NCBI-ProteinID:  BAK10583 UniProt:  A0A0H3KTU9 LinkDB All DBs Position 615599..615712 Genome browser AA seq 37 aa AA seqDB search MWYFAWILGTLLACAFGIITALAIEHIEDSAASDRQS NT seq 114 nt NT seq  +upstreamnt  +downstreamnt atgtggtattttgcctggattcttggcaccttgctggcctgcgcctttggtatcatcacg gcgctggccatagagcatatcgaagacagcgccgcatcggatcgacaatcctga

DBGET integrated database retrieval system