KEGG   Pantoea ananatis AJ13355: PAJ_1610
Entry
PAJ_1610          CDS       T01969                                 
Symbol
fliI
Name
(GenBank) flagellum-specific ATP synthase FliI
  KO
K02412  flagellum-specific ATP synthase [EC:7.4.2.8]
Organism
paj  Pantoea ananatis AJ13355
Pathway
paj02040  Flagellar assembly
Brite
KEGG Orthology (KO) [BR:paj00001]
 09140 Cellular Processes
  09142 Cell motility
   02040 Flagellar assembly
    PAJ_1610 (fliI)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02044 Secretion system [BR:paj02044]
    PAJ_1610 (fliI)
   02035 Bacterial motility proteins [BR:paj02035]
    PAJ_1610 (fliI)
Enzymes [BR:paj01000]
 7. Translocases
  7.4  Catalysing the translocation of amino acids and peptides
   7.4.2  Linked to the hydrolysis of a nucleoside triphosphate
    7.4.2.8  protein-secreting ATPase
     PAJ_1610 (fliI)
Secretion system [BR:paj02044]
 Type III secretion system
  Flagellar export apparatus
   PAJ_1610 (fliI)
Bacterial motility proteins [BR:paj02035]
 Flagellar system
  Flagellar assembly proteins
   Type-III secretion
    PAJ_1610 (fliI)
SSDB
Motif
Pfam: ATP-synt_ab T3SS_ATPase_C ABC_tran AAA_22
Other DBs
NCBI-ProteinID: BAK11690
UniProt: A0A0H3L1E4
LinkDB
Position
1937875..1939236
AA seq 453 aa
MTTRLNRWLGSLDAFESRISQVQPIRRYGRLTRATGLVLEATGLQLPLGSTCVIERNDGK
SISEIESEVVGFNGQKLLMMPLEEVDGILPGARVYARATGENPQAGKQLLLGPQLLGRVL
DGSGRPLDGLPSPETGYRAALNTPPFNPLQRTPITDVLDTGVRAINALLTVGRGQRMGLF
AGSGVGKSVLLGMMARYTQADVIVVGLIGERGREVKDFIENILGAEGRARSVVIAAPADV
SPLLRLQGAAYATRIAEDFRDRGKHVLLIMDSLTRYAMAQREIALAIGEPPATKGYPPSV
FAKLPALVERAGNGIDGGGSITAFYTVLTEGDDQQDPIADSARAILDGHIVLSRRLAEAG
HYPAIDIEASISRAMTSLIDENHYARVRQFKQLLSSFQRNRDLVSVGAYAAGSDPMLDKA
IQLYPQMEAFLQQGIFERSEYDDACLHLHALFG
NT seq 1362 nt   +upstreamnt  +downstreamnt
atgaccacacgtctgaaccgctggcttggctcgcttgatgcctttgagagtcgtatttct
caggtacaaccgattcgtcgttatgggcgtttgacccgtgccaccggcctggtactggag
gcgaccggcctgcagctgcccctgggttcaacctgtgtgattgagcgcaacgacgggaag
agcatcagcgaaatcgaaagtgaagtcgtcggtttcaacggtcagaaactgctgatgatg
ccgctggaagaagtggacggcattctgccgggggcgcgcgtttatgcccgggctaccggt
gaaaacccgcaggccggaaaacagcttttactcggtccgcagctgctgggccgtgtcctt
gacggcagcggacggccgctcgatggcttaccgtcaccggaaactggctaccgtgcggca
ctaaatactccaccgtttaaccccttacagcgcacgcccatcactgatgtcctggatacg
ggcgttcgggctatcaacgccctgctcaccgttggccgtggtcaacgtatgggcctgttt
gccggttcaggcgtgggtaaaagcgtgctgctcggcatgatggcgcgttacacccaggcc
gatgtgatcgttgtcgggttaatcggtgagcgtggtcgtgaagttaaagactttattgaa
aacattttaggcgcggaaggccgtgcccgttccgtggtgattgcggcgccggccgatgtc
tccccgctgttgcgtcttcagggcgcagcctatgccacacgtattgcagaagacttccgc
gatcgcggtaagcacgtcctgttaatcatggactccctgacgcgttacgccatggcccag
cgtgagattgcactggcaatcggtgagccaccggccactaaaggttatccaccgtctgtt
ttcgctaagctcccggccctggttgagcgcgccggtaacggtatcgatggcggcggctcc
attacggctttttataccgttctgaccgaaggcgacgaccagcaggatccgattgcagac
tctgcccgcgcaatcctagacggacacatcgtgttgtcacgtcgcctcgcggaggccgga
cactatccggctattgatattgaagcgtcaatcagtcgtgccatgacatcactgattgat
gaaaatcactatgcacgcgtacgccagttcaagcagttgctttcaagttttcagcgcaac
cgtgacctggtcagcgtcggcgcctatgccgcaggcagcgatcccatgctggacaaagct
attcagctttacccgcagatggaagccttcctgcaacaaggcatttttgaacgcagtgag
tacgacgacgcctgcctgcatttgcacgccttgtttggctag

DBGET integrated database retrieval system