Photorhabdus akhurstii: B0X70_14470 Help Entry B0X70_14470       CDS       T07392                                  Name (GenBank) acyl carrier protein   KO K02078   acyl carrier protein Organism pakh  Photorhabdus akhurstii Pathway pakh01100   Metabolic pathways pakh01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:pakh00001]  09100 Metabolism   09103 Lipid metabolism    00061 Fatty acid biosynthesis     B0X70_14470    00074 Mycolic acid biosynthesis     B0X70_14470   09110 Biosynthesis of other secondary metabolites    00998 Biosynthesis of various antibiotics     B0X70_14470 BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  PP-binding PP-binding_2 ACP_SdgA_C Ribosomal_L12_N DUF5783 Ribosomal_L50 DUF6137 DUF8312 Motif Other DBs NCBI-ProteinID:  QXF34217 UniProt:  A0ABX8LZC8 LinkDB All DBs Position complement(3325566..3325802) Genome browser AA seq 78 aa AA seqDB search MSTIEERVKKIIVEQLGVKEEEVVNSASFVDDLGADSLDTVELVMALEEEFDIEIPDEEA EKITTVQAAIDYVQNQSE NT seq 237 nt NT seq  +upstreamnt  +downstreamnt atgagcactattgaagaacgcgttaaaaaaatcatcgttgaacaacttggtgttaaagag gaagaggttgttaattcagcttcttttgtagatgacttgggcgctgattctcttgacaca gttgaactggtaatggctctggaagaagagttcgatatcgaaattccagatgaagaagca gaaaagatcactacagttcaggcagctattgattacgtccagaaccaaagcgaataa

DBGET integrated database retrieval system