Photorhabdus akhurstii: B0X70_19255 Help Entry B0X70_19255       CDS       T07392                                  Name (GenBank) DNA-binding protein HU   KO K03530   DNA-binding protein HU-beta Organism pakh  Photorhabdus akhurstii Brite KEGG Orthology (KO) [BR:pakh00001]  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03032 DNA replication proteins [BR:pakh03032]     B0X70_19255    03036 Chromosome and associated proteins [BR:pakh03036]     B0X70_19255    03400 DNA repair and recombination proteins [BR:pakh03400]     B0X70_19255 DNA replication proteins [BR:pakh03032]  Prokaryotic type   DNA Replication Initiation Factors    Initiation factors (bacterial)     B0X70_19255 Chromosome and associated proteins [BR:pakh03036]  Prokaryotic type   Nucleoid associated proteins    HU (heat unstable protein)     B0X70_19255 DNA repair and recombination proteins [BR:pakh03400]  Prokaryotic type   DSBR (double strand breaks repair)    NHEJ (non-homologous end-joining)     SHIIR (short-homology-independent illegitimate recombination)      Supressor       B0X70_19255 BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  Bac_DNA_binding HU-HIG HU-CCDC81_bac_2 HU-CCDC81_euk_2 Motif Other DBs NCBI-ProteinID:  QXF35073 UniProt:  A0ABX8M1R8 LinkDB All DBs Position complement(4446375..4446665) Genome browser AA seq 96 aa AA seqDB search MGMIRVNKSQLIDKIAADSNISKAAAGRVVDAFISSVTGALKDGDDVALVGFGTFAVRER SARTGRNPQTGKELKIAAAKVPAFRPGKGLKDAVNG NT seq 291 nt NT seq  +upstreamnt  +downstreamnt atggggatgataagagtgaataaatcacaactgatcgacaagattgctgctgactctaat atttctaaagcagccgcagggcgtgtagtagatgcatttatttcttctgtaacgggtgca ttgaaggatggcgatgatgttgctctggtgggattcggtacttttgctgttcgtgaacgt tctgcacgtacaggccgtaaccctcaaacaggaaaagagctcaaaattgctgcggctaaa gtacctgctttccgtccaggtaaaggtttgaaagacgctgttaatgggtga

DBGET integrated database retrieval system