Photorhabdus akhurstii: B0X70_23630 Help Entry B0X70_23630       CDS       T07392                                  Name (GenBank) hypothetical protein   KO K02078   acyl carrier protein Organism pakh  Photorhabdus akhurstii Pathway pakh01100   Metabolic pathways pakh01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:pakh00001]  09100 Metabolism   09103 Lipid metabolism    00061 Fatty acid biosynthesis     B0X70_23630    00074 Mycolic acid biosynthesis     B0X70_23630   09110 Biosynthesis of other secondary metabolites    00998 Biosynthesis of various antibiotics     B0X70_23630 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  PP-binding ACP_SdgA_C Motif Other DBs NCBI-ProteinID:  QXF35855 UniProt:  A0ABX8M123 LinkDB All DBs Position 5459035..5459271 Genome browser AA seq 78 aa AA seqDB search MKLFELLQSQITELTDIEPEDITLDTLLDDIHLVSLDFVSIQVALKREMGIQLNFDKFQR DNTTTIGDFVNYVSELAK NT seq 237 nt NT seq  +upstreamnt  +downstreamnt atgaaactatttgaattacttcaatctcaaattactgaattaactgatatcgaaccagaa gatattactcttgacactctacttgatgatattcatttagtgagtctggatttcgtttct attcaggttgctttaaaaagagaaatgggcattcaactgaatttcgataagttccaacga gacaacacaacgacaatcggtgattttgtcaattatgtcagtgaattagcaaaataa

DBGET integrated database retrieval system