Paenibacillus albus: EJC50_14980 Help Entry EJC50_14980       CDS       T06567                                  Symbol acpP Name (GenBank) acyl carrier protein   KO K02078   acyl carrier protein Organism palb  Paenibacillus albus Pathway palb01100   Metabolic pathways palb01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:palb00001]  09100 Metabolism   09103 Lipid metabolism    00061 Fatty acid biosynthesis     EJC50_14980 (acpP)    00074 Mycolic acid biosynthesis     EJC50_14980 (acpP)   09110 Biosynthesis of other secondary metabolites    00998 Biosynthesis of various antibiotics     EJC50_14980 (acpP) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  PP-binding PP-binding_2 DUF7080 Motif Other DBs NCBI-ProteinID:  AZN40823 UniProt:  A0A3Q8X5X3 LinkDB All DBs Position 3291941..3292177 Genome browser AA seq 78 aa AA seqDB search MSDVYDRVKRIVVDRLGVDESEVSLEASFKEDLGADSLDVVELVMELEDEFDMEISDEDA EKITSVGEVVNYISSLAK NT seq 237 nt NT seq  +upstreamnt  +downstreamnt atgtccgatgtatatgatcgtgtaaaacgcatcgttgtcgaccgccttggcgtagatgaa tcggaagtgtctctcgaggcttcgtttaaagaagatcttggagcagactctcttgatgtc gtagaactcgtcatggaactggaagatgagttcgatatggaaatctctgatgaagatgca gagaaaattacgagtgtaggggaagttgttaattacatatcttctctagctaagtaa

DBGET integrated database retrieval system