Aquipseudomonas alcaligenes: A0T30_14880 Help Entry A0T30_14880       CDS       T04318                                  Name (GenBank) cyd operon protein YbgT   KO K00424   cytochrome bd-I ubiquinol oxidase subunit X [EC:7.1.1.7] Organism palc  Aquipseudomonas alcaligenes Pathway palc00190   Oxidative phosphorylation palc01100   Metabolic pathways palc02020   Two-component system Module palc_M00153   Cytochrome bd ubiquinol oxidase Brite KEGG Orthology (KO) [BR:palc00001]  09100 Metabolism   09102 Energy metabolism    00190 Oxidative phosphorylation     A0T30_14880  09130 Environmental Information Processing   09132 Signal transduction    02020 Two-component system     A0T30_14880 Enzymes [BR:palc01000]  7. Translocases   7.1  Catalysing the translocation of protons    7.1.1  Linked to oxidoreductase reactions     7.1.1.7  quinol oxidase (electrogenic, proton-motive force generating)      A0T30_14880 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  YbgT_YccB Motif Other DBs NCBI-ProteinID:  AMR67585 UniProt:  A0A142ITF3 LinkDB All DBs Position 3245473..3245589 Genome browser AA seq 38 aa AA seqDB search MWYFTWILGVLLACSFGIINALWLETTQNLDEEPVGDD NT seq 117 nt NT seq  +upstreamnt  +downstreamnt atgtggtatttcacctggattctcggtgtgttgctggcctgcagcttcggcatcatcaat gccctgtggctggagaccacgcagaacctcgacgaggaaccggtcggtgacgactga

DBGET integrated database retrieval system