Pseudomonas alloputida: LU682_008325
Help
Entry
LU682_008325 CDS
T09345
Name
(GenBank) chemotaxis response regulator protein-glutamate methylesterase
KO
K03412
two-component system, chemotaxis family, protein-glutamate methylesterase/glutaminase [EC:
3.1.1.61
3.5.1.44
]
Organism
pald
Pseudomonas alloputida
Pathway
pald02020
Two-component system
pald02030
Bacterial chemotaxis
Brite
KEGG Orthology (KO) [BR:
pald00001
]
09130 Environmental Information Processing
09132 Signal transduction
02020 Two-component system
LU682_008325
09140 Cellular Processes
09142 Cell motility
02030 Bacterial chemotaxis
LU682_008325
09180 Brite Hierarchies
09183 Protein families: signaling and cellular processes
02022 Two-component system [BR:
pald02022
]
LU682_008325
02035 Bacterial motility proteins [BR:
pald02035
]
LU682_008325
Enzymes [BR:
pald01000
]
3. Hydrolases
3.1 Acting on ester bonds
3.1.1 Carboxylic-ester hydrolases
3.1.1.61 protein-glutamate methylesterase
LU682_008325
3.5 Acting on carbon-nitrogen bonds, other than peptide bonds
3.5.1 In linear amides
3.5.1.44 protein-glutamine glutaminase
LU682_008325
Two-component system [BR:
pald02022
]
CheA family
CheA-CheYBV (chemotaxis)
LU682_008325
Bacterial motility proteins [BR:
pald02035
]
Flagellar system
Chemotaxis proteins
Two component system proteins
LU682_008325
BRITE hierarchy
SSDB
Ortholog
Paralog
Gene cluster
GFIT
Motif
Pfam:
CheB_methylest
Response_reg
Stb3
Motif
Other DBs
NCBI-ProteinID:
WJR18811
LinkDB
All DBs
Position
1789809..1790921
Genome browser
AA seq
370 aa
AA seq
DB search
MAVKVLVVDDSGFFRRRVSEILSADPTIQVVGTATNGKEAIDQALALKPDVITMDYEMPM
MDGITAVRHIMQRCPTPVLMFSSLTHEGARVTLDALDAGAVDYLPKNFEDISRNPDKVKQ
LLCEKVHTISRSNRRIGSYARTAPVAAPAPASTFTSQAQTRPAAPARAAAPTPAASQSPA
PKRKPYKLVAIGTSTGGPVALQRVLTQLPANFPAPIVLIQHMPAAFTKAFAERLDKLCRI
SVKEAEDGDMLRPGLALLAPGGKQMMIDGRGTVKILPGDERLNYKPCVDITFGSAAKSYG
DKVLSVVLTGMGADGREGARLLKQGGSTVWAQDEASCVIYGMPMAIVKANLADAVYSLDE
IGKHLVEACV
NT seq
1113 nt
NT seq
+upstream
nt +downstream
nt
atggcagtcaaggtcctggtggtggatgattctggtttcttccgccgccgtgtctcggaa
atcctctcggcggatccaacgatccaggtagtgggtaccgcgaccaacggcaaggaagca
atcgaccaggcgctggcgctcaagcccgatgtgatcaccatggactacgaaatgcccatg
atggatggcattaccgccgtgcggcacatcatgcagcgctgcccgacgcccgtgttgatg
ttctcgtcgctgacccatgaaggcgcccgcgtcaccctcgacgcgctggatgccggcgca
gtggactacctgccgaaaaacttcgaggacatctcgcgcaaccctgacaaggtcaagcag
ttgctgtgcgagaaggtgcacaccatttcgcgcagcaaccgccggatcggcagctatgcc
agaacggcgccggtcgccgcgccagcgccggccagcacctttaccagccaggcgcagacg
cgcccggcagcgcctgcccgtgcagcggccccgacgccggcggcctcgcagtcgccggca
cccaagcgcaaaccctacaaactggtggccatcggtacctccacgggggggccggtggcg
ctgcagcgggtactgacgcagctgccggccaatttcccggcgccgatcgtgttgatccag
cacatgccggcggccttcaccaaagcgtttgccgaacgcctggacaagctgtgccgcatc
agcgtcaaggaagccgaagacggcgacatgctgcgcccgggcctggccctgctggccccc
ggtggcaagcagatgatgatcgatggccgtggcacggtgaagatcctgcccggcgacgag
cgcctgaactacaagccgtgcgtggacatcaccttcggttcggcggccaagtcgtacggt
gacaaggtgttgtcggtggtgctcaccggcatgggcgccgatggccgcgagggcgcgcgc
ctgctcaagcaggggggcagcacggtgtgggcccaggatgaagccagctgcgtgatttat
ggcatgcccatggccatcgtcaaggcgaacctggcggatgccgtgtacagcctcgacgaa
atcggcaagcacctggtggaggcgtgcgtctga
DBGET
integrated database retrieval system