Pseudomonas alloputida: LU682_021255 Help Entry LU682_021255      CDS       T09345                                  Symbol acpP Name (GenBank) acyl carrier protein   KO K02078   acyl carrier protein Organism pald  Pseudomonas alloputida Pathway pald01100   Metabolic pathways pald01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:pald00001]  09100 Metabolism   09103 Lipid metabolism    00061 Fatty acid biosynthesis     LU682_021255 (acpP)    00074 Mycolic acid biosynthesis     LU682_021255 (acpP)   09110 Biosynthesis of other secondary metabolites    00998 Biosynthesis of various antibiotics     LU682_021255 (acpP) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  PP-binding PP-binding_2 ACP_SdgA_C DUF1896 Fas_alpha_ACP Ribosomal_L50 DUF1493 HLH DUF6952 Motif Other DBs NCBI-ProteinID:  WJR15675 LinkDB All DBs Position complement(4594264..4594500) Genome browser AA seq 78 aa AA seqDB search MSTIEERVKKIVAEQLGVKEEEVTVEKSFVDDLGADSLDTVELVMALEEEFETEIPDEEA EKITTVQAAIDYVKAHQA NT seq 237 nt NT seq  +upstreamnt  +downstreamnt atgagcaccatcgaagaacgcgtcaagaaaatcgtcgccgagcaactgggcgtcaaggaa gaagaagtgactgttgagaagtccttcgtcgatgacctgggtgccgattcgcttgacacc gttgaactggtgatggctctggaagaggaattcgagaccgaaatccctgacgaagaagcc gagaagatcactaccgttcaagctgccatcgactacgtcaaagcccaccaggcctaa

DBGET integrated database retrieval system