Pseudomonas alloputida: LU682_028255 Help Entry LU682_028255      CDS       T09345                                  Name (GenBank) TIGR02449 family protein   KO K09892   cell division protein ZapB Organism pald  Pseudomonas alloputida Brite KEGG Orthology (KO) [BR:pald00001]  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03036 Chromosome and associated proteins [BR:pald03036]     LU682_028255 Chromosome and associated proteins [BR:pald03036]  Prokaryotic type   Chromosome partitioning proteins    Divisome proteins     LU682_028255 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Asd-4 YebO ZapB Motif Other DBs NCBI-ProteinID:  WJR20165 LinkDB All DBs Position 6120800..6120982 Genome browser AA seq 60 aa AA seqDB search MSRFELLIERVEQLKRQNALLVAQEKSWREERAHLIEKNEIAKRKVESMILRLKALEQDS NT seq 183 nt NT seq  +upstreamnt  +downstreamnt atgagccgattcgagttgctgatcgaacgcgtcgagcaactaaaacggcaaaatgcactc ctagtagctcaggaaaaatcctggcgcgaagagcgcgcccacctcatcgaaaagaacgag atcgccaagcgcaaagtcgagtcgatgattttacgcctcaaggctctggagcaagactca tga

DBGET integrated database retrieval system