Pteropus alecto (black flying fox): 102877949 Help Entry 102877949         CDS       T02993                                  Symbol UBL5 Name (RefSeq) ubiquitin-like protein 5   KO K13113   ubiquitin-like protein 5 Organism pale  Pteropus alecto (black flying fox) Brite KEGG Orthology (KO) [BR:pale00001]  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03041 Spliceosome [BR:pale03041]     102877949 (UBL5)   09183 Protein families: signaling and cellular processes    04052 Cytokines and neuropeptides [BR:pale04052]     102877949 (UBL5) Spliceosome [BR:pale03041]  Complex B   Other components    Complex B specific factors     102877949 (UBL5) Cytokines and neuropeptides [BR:pale04052]  Neuropeptides   Unclassified    102877949 (UBL5) BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  ubiquitin Ubiquitin_2 Crinkler Motif Other DBs NCBI-GeneID:  102877949 NCBI-ProteinID:  XP_006905962 UniProt:  L5L4A9 LinkDB All DBs Position Unknown AA seq 73 aa AA seqDB search MIEVVCNDRLGKKVRVKCNTDDTIGDLKKLIAAQTGTRWNKIVLKKWYTIFKDHVSLGDY EIHDGMNLELYYQ NT seq 222 nt NT seq  +upstreamnt  +downstreamnt atgatcgaggttgtttgcaacgaccgtctggggaagaaggtccgcgtgaaatgcaacacc gatgacaccatcggggaccttaagaagctgatcgcagcccaaactggtacccgttggaac aagattgtactaaagaagtggtacacgatttttaaggaccacgtttctctgggggactat gaaatccacgatgggatgaacctggagctttattaccaataa

DBGET integrated database retrieval system