Pteropus alecto (black flying fox): 102878371 Help Entry 102878371         CDS       T02993                                  Symbol CCL5 Name (RefSeq) C-C motif chemokine 5   KO K12499   C-C motif chemokine 5 Organism pale  Pteropus alecto (black flying fox) Pathway pale04060   Cytokine-cytokine receptor interaction pale04061   Viral protein interaction with cytokine and cytokine receptor pale04062   Chemokine signaling pathway pale04620   Toll-like receptor signaling pathway pale04621   NOD-like receptor signaling pathway pale04623   Cytosolic DNA-sensing pathway pale04668   TNF signaling pathway pale05020   Prion disease pale05142   Chagas disease pale05163   Human cytomegalovirus infection pale05164   Influenza A pale05168   Herpes simplex virus 1 infection pale05323   Rheumatoid arthritis pale05417   Lipid and atherosclerosis Brite KEGG Orthology (KO) [BR:pale00001]  09130 Environmental Information Processing   09132 Signal transduction    04668 TNF signaling pathway     102878371 (CCL5)   09133 Signaling molecules and interaction    04060 Cytokine-cytokine receptor interaction     102878371 (CCL5)    04061 Viral protein interaction with cytokine and cytokine receptor     102878371 (CCL5)  09150 Organismal Systems   09151 Immune system    04620 Toll-like receptor signaling pathway     102878371 (CCL5)    04621 NOD-like receptor signaling pathway     102878371 (CCL5)    04623 Cytosolic DNA-sensing pathway     102878371 (CCL5)    04062 Chemokine signaling pathway     102878371 (CCL5)  09160 Human Diseases   09172 Infectious disease: viral    05164 Influenza A     102878371 (CCL5)    05168 Herpes simplex virus 1 infection     102878371 (CCL5)    05163 Human cytomegalovirus infection     102878371 (CCL5)   09174 Infectious disease: parasitic    05142 Chagas disease     102878371 (CCL5)   09163 Immune disease    05323 Rheumatoid arthritis     102878371 (CCL5)   09164 Neurodegenerative disease    05020 Prion disease     102878371 (CCL5)   09166 Cardiovascular disease    05417 Lipid and atherosclerosis     102878371 (CCL5)  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    04052 Cytokines and neuropeptides [BR:pale04052]     102878371 (CCL5)    00536 Glycosaminoglycan binding proteins [BR:pale00536]     102878371 (CCL5) Cytokines and neuropeptides [BR:pale04052]  Cytokines   Chemokines    102878371 (CCL5) Glycosaminoglycan binding proteins [BR:pale00536]  Heparan sulfate / Heparin   Chemokines    102878371 (CCL5) BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  IL8 CXCL16 DUF4148 Motif Other DBs NCBI-GeneID:  102878371 NCBI-ProteinID:  XP_006925003 LinkDB All DBs Position Unknown AA seq 91 aa AA seqDB search MKLSAAALAVLLATAAFCAPSSASPYASDTTPCCFAYISRPLPRAHLQEYFYTSSKCSIP AVVFITRKKRQVCADPEKRWVREYINSFEMS NT seq 276 nt NT seq  +upstreamnt  +downstreamnt atgaagctctctgcagctgccctcgctgtccttcttgccactgccgccttctgcgctcct tcatctgcctccccatatgcctcggacaccacaccttgctgctttgcctacatctctcgc ccactgccccgtgcccacctccaggagtatttctacaccagcagcaagtgctccatccca gcagtcgtcttcattacccgaaaaaaacgccaggtgtgtgccgacccagagaagagatgg gtacgggaatacatcaactccttcgagatgagctag

DBGET integrated database retrieval system