Pteropus alecto (black flying fox): 102878513 Help Entry 102878513         CDS       T02993                                  Name (RefSeq) histone H2B type 1-A   KO K11252   histone H2B Organism pale  Pteropus alecto (black flying fox) Pathway pale04613   Neutrophil extracellular trap formation pale05034   Alcoholism pale05203   Viral carcinogenesis pale05322   Systemic lupus erythematosus Brite KEGG Orthology (KO) [BR:pale00001]  09150 Organismal Systems   09151 Immune system    04613 Neutrophil extracellular trap formation     102878513  09160 Human Diseases   09161 Cancer: overview    05203 Viral carcinogenesis     102878513   09163 Immune disease    05322 Systemic lupus erythematosus     102878513   09165 Substance dependence    05034 Alcoholism     102878513  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03036 Chromosome and associated proteins [BR:pale03036]     102878513   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:pale04147]     102878513 Chromosome and associated proteins [BR:pale03036]  Eukaryotic type   Nucleosome assembly factors    Histones     102878513 Exosome [BR:pale04147]  Exosomal proteins   Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)    102878513 BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  Histone CBFD_NFYB_HMF TFIID_20kDa YscO-like DUF6246 Motif Other DBs NCBI-GeneID:  102878513 NCBI-ProteinID:  XP_006923548 UniProt:  L5JW43 LinkDB All DBs Position Unknown AA seq 127 aa AA seqDB search MPELTSKGATVSKKGFKKAVTKTQKKEGKKRKRCRKESYSIYIYKVLKQVHPDTGISSKA MGIMNSFVNDIFERIAGEASRLAHYNKRSTITSREIQTAVRLLLPGELAKHAVSEGTKAV TKYTSSK NT seq 384 nt NT seq  +upstreamnt  +downstreamnt atgccggagctgacctctaagggcgctactgtctccaagaagggcttcaagaaagccgtc actaagacgcagaagaaggaggggaagaaacgcaagcggtgccgcaaagagagctattcg atttacatctacaaggtgttgaagcaggtgcaccccgacaccggcatctcgtccaaggcc atgggcatcatgaactcgttcgtcaacgacatcttcgagcgcatcgcgggcgaggcgtcg cgcctggcgcattacaacaagcgctcgaccatcacgtcgcgggagatccagacggccgtg cgcctgctgctgcccggggagctggccaagcacgccgtgtccgagggcaccaaggccgtc accaagtacaccagctccaagtaa

DBGET integrated database retrieval system