Pteropus alecto (black flying fox): 102879159 Help Entry 102879159         CDS       T02993                                  Name (RefSeq) cytochrome c   KO K08738   cytochrome c Organism pale  Pteropus alecto (black flying fox) Pathway pale00190   Oxidative phosphorylation pale01100   Metabolic pathways pale01524   Platinum drug resistance pale04115   p53 signaling pathway pale04210   Apoptosis pale04215   Apoptosis - multiple species pale04932   Non-alcoholic fatty liver disease pale05010   Alzheimer disease pale05012   Parkinson disease pale05014   Amyotrophic lateral sclerosis pale05016   Huntington disease pale05017   Spinocerebellar ataxia pale05020   Prion disease pale05022   Pathways of neurodegeneration - multiple diseases pale05132   Salmonella infection pale05134   Legionellosis pale05145   Toxoplasmosis pale05152   Tuberculosis pale05160   Hepatitis C pale05161   Hepatitis B pale05162   Measles pale05163   Human cytomegalovirus infection pale05164   Influenza A pale05167   Kaposi sarcoma-associated herpesvirus infection pale05168   Herpes simplex virus 1 infection pale05169   Epstein-Barr virus infection pale05170   Human immunodeficiency virus 1 infection pale05200   Pathways in cancer pale05210   Colorectal cancer pale05222   Small cell lung cancer pale05416   Viral myocarditis pale05417   Lipid and atherosclerosis Brite KEGG Orthology (KO) [BR:pale00001]  09100 Metabolism   09102 Energy metabolism    00190 Oxidative phosphorylation     102879159  09140 Cellular Processes   09143 Cell growth and death    04210 Apoptosis     102879159    04215 Apoptosis - multiple species     102879159    04115 p53 signaling pathway     102879159  09160 Human Diseases   09161 Cancer: overview    05200 Pathways in cancer     102879159   09162 Cancer: specific types    05210 Colorectal cancer     102879159    05222 Small cell lung cancer     102879159   09172 Infectious disease: viral    05170 Human immunodeficiency virus 1 infection     102879159    05161 Hepatitis B     102879159    05160 Hepatitis C     102879159    05164 Influenza A     102879159    05162 Measles     102879159    05168 Herpes simplex virus 1 infection     102879159    05163 Human cytomegalovirus infection     102879159    05167 Kaposi sarcoma-associated herpesvirus infection     102879159    05169 Epstein-Barr virus infection     102879159   09171 Infectious disease: bacterial    05132 Salmonella infection     102879159    05134 Legionellosis     102879159    05152 Tuberculosis     102879159   09174 Infectious disease: parasitic    05145 Toxoplasmosis     102879159   09164 Neurodegenerative disease    05010 Alzheimer disease     102879159    05012 Parkinson disease     102879159    05014 Amyotrophic lateral sclerosis     102879159    05016 Huntington disease     102879159    05017 Spinocerebellar ataxia     102879159    05020 Prion disease     102879159    05022 Pathways of neurodegeneration - multiple diseases     102879159   09166 Cardiovascular disease    05417 Lipid and atherosclerosis     102879159    05416 Viral myocarditis     102879159   09167 Endocrine and metabolic disease    04932 Non-alcoholic fatty liver disease     102879159   09176 Drug resistance: antineoplastic    01524 Platinum drug resistance     102879159 BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  Cytochrom_C Cytochrome_CBB3 Cytochrom_C550 CCP_MauG Motif Other DBs NCBI-GeneID:  102879159 NCBI-ProteinID:  XP_006912065 LinkDB All DBs Position Unknown AA seq 105 aa AA seqDB search MGDVEKGKKIFVQKCAQCHTVEKGGKHKTGPNLHGLFGRKTGQAPGFSYTDANKNKGITW GEETLMEYLENPKKYIPGTKMIFAGIKKSGERADLIAYLKKATKE NT seq 318 nt NT seq  +upstreamnt  +downstreamnt atgggtgatgttgagaagggcaagaagatttttgttcagaagtgtgcccagtgccatact gtggaaaaaggaggcaagcacaagactgggccaaatctccatggtctgtttgggcgaaag acaggtcaggcccctggattttcttacacggatgccaacaagaacaaaggcatcacctgg ggagaggagacactgatggagtatttggagaatcccaagaagtacatccctggaacaaaa atgatctttgctggcattaagaagtctggagaaagggcagacttgatagcttatctcaaa aaagctaccaaggagtaa

DBGET integrated database retrieval system