Pteropus alecto (black flying fox): 102880265 Help Entry 102880265         CDS       T02993                                  Symbol CCK Name (RefSeq) cholecystokinin   KO K05226   cholecystokinin Organism pale  Pteropus alecto (black flying fox) Pathway pale04080   Neuroactive ligand-receptor interaction pale04081   Hormone signaling pale04911   Insulin secretion pale04972   Pancreatic secretion Brite KEGG Orthology (KO) [BR:pale00001]  09130 Environmental Information Processing   09133 Signaling molecules and interaction    04080 Neuroactive ligand-receptor interaction     102880265 (CCK)    04081 Hormone signaling     102880265 (CCK)  09150 Organismal Systems   09152 Endocrine system    04911 Insulin secretion     102880265 (CCK)   09154 Digestive system    04972 Pancreatic secretion     102880265 (CCK)  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    04052 Cytokines and neuropeptides [BR:pale04052]     102880265 (CCK) Cytokines and neuropeptides [BR:pale04052]  Neuropeptides   GPCR binding    102880265 (CCK) BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  Gastrin Motif Other DBs NCBI-GeneID:  102880265 NCBI-ProteinID:  XP_006914880 LinkDB All DBs Position Unknown AA seq 115 aa AA seqDB search MNSGVCLCVLMAVLAAGALAQPVSPADLEGPGAQREKEAPRRQLRAVHRMDGEPRAHLGA LLARYIQQARKAPSGRMSVIKNLQGLDPSHRISDRDYMGWMDFGRRSAEEYEYPS NT seq 348 nt NT seq  +upstreamnt  +downstreamnt atgaatagcggcgtgtgcttgtgcgtgctgatggcggtgctggctgccggcgccctggcg cagcctgtgtctcccgcggacctcgagggccctggggcgcagcgggagaaggaggcgccc cggaggcagctgagagcagtgcacaggatggacggcgagccgcgagcgcacctgggcgcg ctgctggccagatacatccagcaggcccggaaagctccttccggccgaatgtcggtgatt aagaacctgcagggcctggaccccagccacaggataagcgaccgggactacatgggctgg atggacttcggccggcgcagcgcggaggagtacgagtacccctcgtag

DBGET integrated database retrieval system