Pteropus alecto (black flying fox): 102881492 Help Entry 102881492         CDS       T02993                                  Symbol CLDN7 Name (RefSeq) claudin-7   KO K06087   claudin Organism pale  Pteropus alecto (black flying fox) Pathway pale03272   Virion - Hepatitis viruses pale04382   Cornified envelope formation pale04514   Cell adhesion molecules pale04530   Tight junction pale04670   Leukocyte transendothelial migration pale05160   Hepatitis C Brite KEGG Orthology (KO) [BR:pale00001]  09120 Genetic Information Processing   09125 Information processing in viruses    03272 Virion - Hepatitis viruses     102881492 (CLDN7)  09130 Environmental Information Processing   09133 Signaling molecules and interaction    04514 Cell adhesion molecules     102881492 (CLDN7)  09140 Cellular Processes   09144 Cellular community - eukaryotes    04530 Tight junction     102881492 (CLDN7)  09150 Organismal Systems   09151 Immune system    04670 Leukocyte transendothelial migration     102881492 (CLDN7)   09158 Development and regeneration    04382 Cornified envelope formation     102881492 (CLDN7)  09160 Human Diseases   09172 Infectious disease: viral    05160 Hepatitis C     102881492 (CLDN7)  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    03037 Cilium and associated proteins [BR:pale03037]     102881492 (CLDN7)    04147 Exosome [BR:pale04147]     102881492 (CLDN7)    04515 Cell adhesion molecules [BR:pale04515]     102881492 (CLDN7) Cilium and associated proteins [BR:pale03037]  Other cilia and associated proteins   Stereociliary proteins    102881492 (CLDN7) Exosome [BR:pale04147]  Exosomal proteins   Exosomal proteins of ovarian cancer cells    102881492 (CLDN7)   Exosomal proteins of colorectal cancer cells    102881492 (CLDN7) Cell adhesion molecules [BR:pale04515]  Immunoglobulin superfamily   L1 family    102881492 (CLDN7) BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  PMP22_Claudin Claudin_2 Clc-like OppC_N Motif Other DBs NCBI-GeneID:  102881492 NCBI-ProteinID:  XP_006922363 UniProt:  L5JZW3 LinkDB All DBs Position Unknown AA seq 211 aa AA seqDB search MANSGLQLLGFSMALLGWVGLVACTAIPQWQMSSYAGDNIITAQAMYKGLWMDCVTQSTG MMSCKMYDSVLALPAAIQATRALMVVSLVLGFLAMFVATIGMKCTRCGGDDKVKKARIAM TGGIIFIVAGLAALIACSWYGHKIVTDFYNPLVPTNIKYEFGPAIFIGWAGSALALLGGA LLSCSCPGSESKAGYRAPRSYPKPNSAKEYV NT seq 636 nt NT seq  +upstreamnt  +downstreamnt atggccaattcgggcctgcagctgctgggcttttccatggccttgctgggctgggtgggc ctggtggcgtgcaccgccattccgcagtggcagatgagttcgtacgcgggcgacaacatc atcacggcccaggccatgtacaaggggttgtggatggactgcgtcacgcagagcacgggc atgatgagctgcaagatgtacgactcggtgctcgccctgccggcggccattcaggccact cgagccctaatggtggtatccctggtgctcggcttcctggccatgttcgtggccacaata ggcatgaagtgtacacgctgtgggggagacgacaaagtgaagaaggcccgtatagctatg actggaggcatcattttcattgtggcaggtcttgctgctttgatagcttgctcctggtat ggccacaagattgtcacagacttttataaccctttggtccccacgaatattaagtacgag tttggtcctgctatcttcattggctgggcagggtctgctctggccctcctgggaggtgca ctgctctcttgctcttgtcctgggagtgagagcaaagctggataccgtgcaccccgctcc taccctaagcccaactctgccaaggagtatgtgtga

DBGET integrated database retrieval system