Pteropus alecto (black flying fox): 102881941 Help Entry 102881941         CDS       T02993                                  Symbol RRAS Name (RefSeq) ras-related protein R-Ras   KO K07829   Ras-related protein R-Ras Organism pale  Pteropus alecto (black flying fox) Pathway pale04010   MAPK signaling pathway pale04014   Ras signaling pathway pale04015   Rap1 signaling pathway pale04024   cAMP signaling pathway pale04072   Phospholipase D signaling pathway pale04137   Mitophagy - animal pale04140   Autophagy - animal pale04218   Cellular senescence pale04360   Axon guidance pale04371   Apelin signaling pathway pale04625   C-type lectin receptor signaling pathway pale04810   Regulation of actin cytoskeleton pale05132   Salmonella infection pale05205   Proteoglycans in cancer Brite KEGG Orthology (KO) [BR:pale00001]  09130 Environmental Information Processing   09132 Signal transduction    04010 MAPK signaling pathway     102881941 (RRAS)    04014 Ras signaling pathway     102881941 (RRAS)    04015 Rap1 signaling pathway     102881941 (RRAS)    04371 Apelin signaling pathway     102881941 (RRAS)    04072 Phospholipase D signaling pathway     102881941 (RRAS)    04024 cAMP signaling pathway     102881941 (RRAS)  09140 Cellular Processes   09141 Transport and catabolism    04140 Autophagy - animal     102881941 (RRAS)    04137 Mitophagy - animal     102881941 (RRAS)   09143 Cell growth and death    04218 Cellular senescence     102881941 (RRAS)   09142 Cell motility    04810 Regulation of actin cytoskeleton     102881941 (RRAS)  09150 Organismal Systems   09151 Immune system    04625 C-type lectin receptor signaling pathway     102881941 (RRAS)   09158 Development and regeneration    04360 Axon guidance     102881941 (RRAS)  09160 Human Diseases   09161 Cancer: overview    05205 Proteoglycans in cancer     102881941 (RRAS)   09171 Infectious disease: bacterial    05132 Salmonella infection     102881941 (RRAS)  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    04031 GTP-binding proteins [BR:pale04031]     102881941 (RRAS) GTP-binding proteins [BR:pale04031]  Small (monomeric) G-proteins   Ras Family    Ras [OT]     102881941 (RRAS) BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  Ras Roc Arf GTP_EFTU MMR_HSR1 ATP_bind_1 AAA_22 Motif Other DBs NCBI-GeneID:  102881941 NCBI-ProteinID:  XP_006905176 LinkDB All DBs Position Unknown AA seq 200 aa AA seqDB search PGPGDPPPSETQKLVVVGGGGVGKSALTIQFIQSYFVSDYDPTIEDSYTKICSVDGVPAR LDILDTAGQEEFGAMREQYMRAGHGFLLVFAINDRQSFNEVGKLFTQILRVKDRDDFPIV LVGNKADLETQRQVPRSEASTFSASHHVAYFEASAKLRLNVDEAFEQLVRAVRKYQEQEL PPSPPSAPRKKDGSCPCVLL NT seq 603 nt NT seq  +upstreamnt  +downstreamnt ccgggacccggggaccccccacccagcgagacacaaaagctggtggtcgtgggcggcggc ggcgtgggcaagagtgcgctgaccatccagttcatccagtcctactttgtgtctgactac gaccccaccatcgaagactcctacacgaagatctgctcggtggatggcgtccccgctcgg ctggacatcctggacactgcgggccaggaggagttcggggccatgagagagcagtacatg cgcgccgggcacggtttcctgctggtgtttgccattaatgaccggcagagtttcaacgag gtgggcaagctgttcacgcagatcctccgagtcaaggaccgtgacgacttccccatcgtg ttggttgggaacaaggcagacctcgagacacagcgtcaggtcccccgatctgaagcctcc accttcagtgcctcccaccacgtggcctacttcgaggcctcggccaaactgcgcctcaac gtggacgaggccttcgagcagctggtgcgggctgtccgtaagtaccaggaacaagagctc ccgcccagcccgcccagtgcccccaggaagaaggatgggagctgcccctgcgtcctcctg tag

DBGET integrated database retrieval system