Pteropus alecto (black flying fox): 102882423 Help Entry 102882423         CDS       T02993                                  Name (RefSeq) thioredoxin-like isoform X1   KO K03671   thioredoxin Organism pale  Pteropus alecto (black flying fox) Pathway pale04621   NOD-like receptor signaling pathway pale05012   Parkinson disease pale05132   Salmonella infection pale05418   Fluid shear stress and atherosclerosis Brite KEGG Orthology (KO) [BR:pale00001]  09150 Organismal Systems   09151 Immune system    04621 NOD-like receptor signaling pathway     102882423  09160 Human Diseases   09171 Infectious disease: bacterial    05132 Salmonella infection     102882423   09164 Neurodegenerative disease    05012 Parkinson disease     102882423   09166 Cardiovascular disease    05418 Fluid shear stress and atherosclerosis     102882423  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03110 Chaperones and folding catalysts [BR:pale03110]     102882423 Chaperones and folding catalysts [BR:pale03110]  Protein folding catalysts   Protein disulfide isomerase    102882423 BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  Thioredoxin Motif Other DBs NCBI-GeneID:  102882423 NCBI-ProteinID:  XP_024907966 LinkDB All DBs Position Unknown AA seq 112 aa AA seqDB search MVKQVERKYAFQEALNSAGDKLTVVDFSATWRGSCKMRKPPFHPPSERYSNAVFLDVKAD RVIVRMLLQSEVECMPTFRFFFFLSFFFLISFSITNLPVLKKGQKMDEFFWS NT seq 339 nt NT seq  +upstreamnt  +downstreamnt atggtgaagcaggtagagagaaagtatgctttccaggaagccttgaacagtgcaggagat aaactcacagtagttgacttctcagccacatggcgtgggtcttgcaaaatgaggaagcct ccctttcatcctccctctgaaaggtactccaatgctgtcttccttgacgtcaaagcagat agggtgatcgtcagaatgttgcttcagagtgaagtcgaatgcatgccaactttccggttt ttcttttttctttcttttttttttttaatttctttttcaattaccaaccttccagttttg aaaaagggacaaaagatggatgagtttttttggagttaa

DBGET integrated database retrieval system