Pteropus alecto (black flying fox): 102883786 Help Entry 102883786         CDS       T02993                                  Name (RefSeq) C-C motif chemokine 2   KO K14624   C-C motif chemokine 2 Organism pale  Pteropus alecto (black flying fox) Pathway pale04060   Cytokine-cytokine receptor interaction pale04061   Viral protein interaction with cytokine and cytokine receptor pale04062   Chemokine signaling pathway pale04621   NOD-like receptor signaling pathway pale04657   IL-17 signaling pathway pale04668   TNF signaling pathway pale04933   AGE-RAGE signaling pathway in diabetic complications pale05135   Yersinia infection pale05142   Chagas disease pale05144   Malaria pale05163   Human cytomegalovirus infection pale05164   Influenza A pale05168   Herpes simplex virus 1 infection pale05171   Coronavirus disease - COVID-19 pale05323   Rheumatoid arthritis pale05417   Lipid and atherosclerosis pale05418   Fluid shear stress and atherosclerosis Brite KEGG Orthology (KO) [BR:pale00001]  09130 Environmental Information Processing   09132 Signal transduction    04668 TNF signaling pathway     102883786   09133 Signaling molecules and interaction    04060 Cytokine-cytokine receptor interaction     102883786    04061 Viral protein interaction with cytokine and cytokine receptor     102883786  09150 Organismal Systems   09151 Immune system    04621 NOD-like receptor signaling pathway     102883786    04657 IL-17 signaling pathway     102883786    04062 Chemokine signaling pathway     102883786  09160 Human Diseases   09172 Infectious disease: viral    05171 Coronavirus disease - COVID-19     102883786    05164 Influenza A     102883786    05168 Herpes simplex virus 1 infection     102883786    05163 Human cytomegalovirus infection     102883786   09171 Infectious disease: bacterial    05135 Yersinia infection     102883786   09174 Infectious disease: parasitic    05144 Malaria     102883786    05142 Chagas disease     102883786   09163 Immune disease    05323 Rheumatoid arthritis     102883786   09166 Cardiovascular disease    05417 Lipid and atherosclerosis     102883786    05418 Fluid shear stress and atherosclerosis     102883786   09167 Endocrine and metabolic disease    04933 AGE-RAGE signaling pathway in diabetic complications     102883786  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    04052 Cytokines and neuropeptides [BR:pale04052]     102883786    00536 Glycosaminoglycan binding proteins [BR:pale00536]     102883786 Cytokines and neuropeptides [BR:pale04052]  Cytokines   Chemokines    102883786 Glycosaminoglycan binding proteins [BR:pale00536]  Heparan sulfate / Heparin   Chemokines    102883786 BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  IL8 CXCL16 GPR15L Motif Other DBs NCBI-GeneID:  102883786 NCBI-ProteinID:  XP_006925025 UniProt:  L5JQV0 LinkDB All DBs Position Unknown AA seq 99 aa AA seqDB search MKVSAGLLCLLLTVAAFSTQVLAQPDGISSPITCCYNFTSKKIPKQRLQSYRTITSSKCP KEAVIFKTKLTKEVCADPKEKWVQDSMKHLDEKTQTPKP NT seq 300 nt NT seq  +upstreamnt  +downstreamnt atgaaggtctctgcagggcttctgtgcctgttgctcacagtggccgccttcagcacccag gtgcttgctcagccagatggaattagttctccaatcacctgctgctataacttcaccagt aagaagatcccgaagcagaggctacagagctacagaacaatcaccagcagcaagtgtccc aaagaagctgtgatcttcaagaccaaactgaccaaggaagtctgtgctgaccccaaggag aagtgggtccaggattccatgaagcacctagacgagaaaacccaaactccaaagccttga

DBGET integrated database retrieval system