Pteropus alecto (black flying fox): 102884227 Help Entry 102884227         CDS       T02993                                  Symbol SOD1 Name (RefSeq) superoxide dismutase [Cu-Zn]   KO K04565   superoxide dismutase, Cu-Zn family [EC:1.15.1.1] Organism pale  Pteropus alecto (black flying fox) Pathway pale04146   Peroxisome pale04213   Longevity regulating pathway - multiple species pale05012   Parkinson disease pale05014   Amyotrophic lateral sclerosis pale05016   Huntington disease pale05020   Prion disease pale05022   Pathways of neurodegeneration - multiple diseases pale05208   Chemical carcinogenesis - reactive oxygen species Brite KEGG Orthology (KO) [BR:pale00001]  09140 Cellular Processes   09141 Transport and catabolism    04146 Peroxisome     102884227 (SOD1)  09150 Organismal Systems   09149 Aging    04213 Longevity regulating pathway - multiple species     102884227 (SOD1)  09160 Human Diseases   09161 Cancer: overview    05208 Chemical carcinogenesis - reactive oxygen species     102884227 (SOD1)   09164 Neurodegenerative disease    05012 Parkinson disease     102884227 (SOD1)    05014 Amyotrophic lateral sclerosis     102884227 (SOD1)    05016 Huntington disease     102884227 (SOD1)    05020 Prion disease     102884227 (SOD1)    05022 Pathways of neurodegeneration - multiple diseases     102884227 (SOD1) Enzymes [BR:pale01000]  1. Oxidoreductases   1.15  Acting on superoxide as acceptor    1.15.1  Acting on superoxide as acceptor (only sub-subclass identified to date)     1.15.1.1  superoxide dismutase      102884227 (SOD1) BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  Sod_Cu Motif Other DBs NCBI-GeneID:  102884227 NCBI-ProteinID:  XP_006908328 LinkDB All DBs Position Unknown AA seq 153 aa AA seqDB search MTTKAVCVLKGDGKVQGTIHFEQKRNGLVVVSGTITGLTEGDHGFHVHQFGDNTQGCTSA GPHFNPLGKTHGGPKDEERHVGDLGNVTAGKDGMAHVHIEDAMIALSGDHSIIGRTMVVH EKPDDLGKGENDESKKTGNAGSRLACGVIGIAQ NT seq 462 nt NT seq  +upstreamnt  +downstreamnt atgacgaccaaggccgtgtgtgtgttgaagggcgatgggaaggtgcagggcaccatccac ttcgagcagaagagaaatgggctggtcgtggtctcgggaaccatcacaggattgactgaa ggtgaccatgggttccacgtccatcagttcggggataatacacaaggctgtaccagtgca ggtcctcacttcaatccacttggcaaaacacatggtgggccaaaggatgaagagaggcat gttggcgacctgggcaacgtgactgccggcaaagatgggatggctcacgtgcacatcgaa gacgctatgattgccctctcgggagaccattccatcattggccgcactatggtggtccat gaaaaaccagatgacttgggcaaaggtgaaaatgatgaaagtaaaaagacgggaaatgct ggaagtcgtttggcttgtggtgtcattgggatcgcccagtaa

DBGET integrated database retrieval system