Pteropus alecto (black flying fox): 102884366 Help Entry 102884366         CDS       T02993                                  Symbol CSNK2B Name (RefSeq) casein kinase II subunit beta   KO K03115   casein kinase II subunit beta Organism pale  Pteropus alecto (black flying fox) Pathway pale03008   Ribosome biogenesis in eukaryotes pale03083   Polycomb repressive complex pale04064   NF-kappa B signaling pathway pale04137   Mitophagy - animal pale04310   Wnt signaling pathway pale04520   Adherens junction pale05010   Alzheimer disease pale05020   Prion disease pale05022   Pathways of neurodegeneration - multiple diseases pale05162   Measles pale05235   PD-L1 expression and PD-1 checkpoint pathway in cancer Brite KEGG Orthology (KO) [BR:pale00001]  09120 Genetic Information Processing   09122 Translation    03008 Ribosome biogenesis in eukaryotes     102884366 (CSNK2B)   09126 Chromosome    03083 Polycomb repressive complex     102884366 (CSNK2B)  09130 Environmental Information Processing   09132 Signal transduction    04310 Wnt signaling pathway     102884366 (CSNK2B)    04064 NF-kappa B signaling pathway     102884366 (CSNK2B)  09140 Cellular Processes   09141 Transport and catabolism    04137 Mitophagy - animal     102884366 (CSNK2B)   09144 Cellular community - eukaryotes    04520 Adherens junction     102884366 (CSNK2B)  09160 Human Diseases   09161 Cancer: overview    05235 PD-L1 expression and PD-1 checkpoint pathway in cancer     102884366 (CSNK2B)   09172 Infectious disease: viral    05162 Measles     102884366 (CSNK2B)   09164 Neurodegenerative disease    05010 Alzheimer disease     102884366 (CSNK2B)    05020 Prion disease     102884366 (CSNK2B)    05022 Pathways of neurodegeneration - multiple diseases     102884366 (CSNK2B)  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03009 Ribosome biogenesis [BR:pale03009]     102884366 (CSNK2B)    03036 Chromosome and associated proteins [BR:pale03036]     102884366 (CSNK2B) Ribosome biogenesis [BR:pale03009]  Eukaryotic type   90S particles    Kinase     102884366 (CSNK2B) Chromosome and associated proteins [BR:pale03036]  Eukaryotic type   Histone modification proteins    Polycomb repressive complex (PRC) and associated proteins     Noncanonical PRC1 (PRC1.3/1.5)      102884366 (CSNK2B) BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  CK_II_beta Motif Other DBs NCBI-GeneID:  102884366 NCBI-ProteinID:  XP_006904716 UniProt:  L5L690 LinkDB All DBs Position Unknown AA seq 215 aa AA seqDB search MSSSEEVSWISWFCGLRGNEFFCEVDEDYIQDKFNLTGLNEQVPHYRQALDMILDLEPDE ELEDNPNQSDLIEQAAEMLYGLIHARYILTNRGIAQMLEKYQQGDFGYCPRVYCENQPML PIGLSDIPGEAMVKLYCPKCMDVYTPKSSRHHHTDGAYFGTGFPHMLFMVHPEYRPKRPA NQFVPRLYGFKIHPMAYQLQLQAASNFKSPVKTIR NT seq 648 nt NT seq  +upstreamnt  +downstreamnt atgagcagctcagaggaggtgtcctggatttcctggttctgtgggctccggggcaatgaa ttcttctgtgaagtggatgaagactacatccaagacaaattcaatctcactggactcaat gagcaggtgcctcactatcgacaagctctagacatgatcttggacctggagcctgatgaa gagctggaagacaaccccaaccagagtgacctgattgaacaggcagccgagatgctttat ggattgatccacgcccgctatatcctcaccaaccgtggcatcgcccagatgttagaaaaa tatcagcagggagactttggctactgtccccgggtgtactgtgagaaccagccaatgctt cccatcggcctttcagacatcccaggtgaggccatggtgaagctctactgccccaagtgc atggacgtgtacacacccaagtcatcaaggcaccaccacacagacggcgcctacttcggc actggttttcctcacatgctgttcatggtgcaccctgagtaccggcccaagcggcctgcc aaccagtttgtgcccaggctctacggtttcaagatccatccgatggcctaccagctgcag ctccaagccgccagcaacttcaagagcccagtcaagacaattcgctga

DBGET integrated database retrieval system