Pteropus alecto (black flying fox): 102885228 Help Entry 102885228         CDS       T02993                                  Symbol NPPC Name (RefSeq) C-type natriuretic peptide   KO K12336   natriuretic peptide C Organism pale  Pteropus alecto (black flying fox) Pathway pale04022   cGMP-PKG signaling pathway pale04081   Hormone signaling pale04270   Vascular smooth muscle contraction pale05418   Fluid shear stress and atherosclerosis Brite KEGG Orthology (KO) [BR:pale00001]  09130 Environmental Information Processing   09132 Signal transduction    04022 cGMP-PKG signaling pathway     102885228 (NPPC)   09133 Signaling molecules and interaction    04081 Hormone signaling     102885228 (NPPC)  09150 Organismal Systems   09153 Circulatory system    04270 Vascular smooth muscle contraction     102885228 (NPPC)  09160 Human Diseases   09166 Cardiovascular disease    05418 Fluid shear stress and atherosclerosis     102885228 (NPPC)  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    04052 Cytokines and neuropeptides [BR:pale04052]     102885228 (NPPC) Cytokines and neuropeptides [BR:pale04052]  Neuropeptides   Unclassified    102885228 (NPPC) BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  ANP Motif Other DBs NCBI-GeneID:  102885228 NCBI-ProteinID:  XP_006906696 LinkDB All DBs Position Unknown AA seq 125 aa AA seqDB search MHLSQLLACVLLLMLLSLRPSEAKPGAAPKVQRTPQGEELAVSQAEGGGQKKRDKTPGGG GANPKGDQSRLFRDLRVETKARAAWARHLQENPNARKNKGIKKGSNKGCFGLKLDRIGST SGLGC NT seq 378 nt NT seq  +upstreamnt  +downstreamnt atgcacctctcccagctgctggcctgcgtcctgctgctcatgctactctcgctccggccc tccgaggccaagcccggggcggcgccgaaggtccagcgaactccgcagggggaggagctg gccgtgtcccaggctgagggcggcggtcagaagaagcgcgacaagacgcccgggggtggc ggcgccaaccccaagggcgaccagtcgcgactcttccgggacctacgagtagaaactaag gctcgggcggcgtgggcccgccatctgcaagagaaccccaacgcgcgcaaaaacaaaggc atcaagaagggctcgaacaagggctgcttcggcctcaagctggaccggatcggctccacc agcggcctgggatgttag

DBGET integrated database retrieval system