KEGG   Pteropus alecto (black flying fox): 102885950
Entry
102885950         CDS       T02993                                 
Symbol
NRAS
Name
(RefSeq) GTPase NRas isoform X2
  KO
K07828  GTPase NRas
Organism
pale  Pteropus alecto (black flying fox)
Pathway
pale01521  EGFR tyrosine kinase inhibitor resistance
pale01522  Endocrine resistance
pale04010  MAPK signaling pathway
pale04012  ErbB signaling pathway
pale04014  Ras signaling pathway
pale04015  Rap1 signaling pathway
pale04062  Chemokine signaling pathway
pale04068  FoxO signaling pathway
pale04071  Sphingolipid signaling pathway
pale04072  Phospholipase D signaling pathway
pale04137  Mitophagy - animal
pale04140  Autophagy - animal
pale04150  mTOR signaling pathway
pale04151  PI3K-Akt signaling pathway
pale04210  Apoptosis
pale04211  Longevity regulating pathway
pale04213  Longevity regulating pathway - multiple species
pale04218  Cellular senescence
pale04360  Axon guidance
pale04370  VEGF signaling pathway
pale04371  Apelin signaling pathway
pale04540  Gap junction
pale04550  Signaling pathways regulating pluripotency of stem cells
pale04625  C-type lectin receptor signaling pathway
pale04650  Natural killer cell mediated cytotoxicity
pale04660  T cell receptor signaling pathway
pale04662  B cell receptor signaling pathway
pale04664  Fc epsilon RI signaling pathway
pale04714  Thermogenesis
pale04720  Long-term potentiation
pale04722  Neurotrophin signaling pathway
pale04725  Cholinergic synapse
pale04726  Serotonergic synapse
pale04730  Long-term depression
pale04810  Regulation of actin cytoskeleton
pale04910  Insulin signaling pathway
pale04912  GnRH signaling pathway
pale04915  Estrogen signaling pathway
pale04916  Melanogenesis
pale04917  Prolactin signaling pathway
pale04919  Thyroid hormone signaling pathway
pale04921  Oxytocin signaling pathway
pale04926  Relaxin signaling pathway
pale04929  GnRH secretion
pale04933  AGE-RAGE signaling pathway in diabetic complications
pale04935  Growth hormone synthesis, secretion and action
pale05010  Alzheimer disease
pale05022  Pathways of neurodegeneration - multiple diseases
pale05034  Alcoholism
pale05160  Hepatitis C
pale05161  Hepatitis B
pale05163  Human cytomegalovirus infection
pale05165  Human papillomavirus infection
pale05166  Human T-cell leukemia virus 1 infection
pale05167  Kaposi sarcoma-associated herpesvirus infection
pale05170  Human immunodeficiency virus 1 infection
pale05200  Pathways in cancer
pale05203  Viral carcinogenesis
pale05205  Proteoglycans in cancer
pale05206  MicroRNAs in cancer
pale05207  Chemical carcinogenesis - receptor activation
pale05208  Chemical carcinogenesis - reactive oxygen species
pale05210  Colorectal cancer
pale05211  Renal cell carcinoma
pale05213  Endometrial cancer
pale05214  Glioma
pale05215  Prostate cancer
pale05216  Thyroid cancer
pale05218  Melanoma
pale05219  Bladder cancer
pale05220  Chronic myeloid leukemia
pale05221  Acute myeloid leukemia
pale05223  Non-small cell lung cancer
pale05224  Breast cancer
pale05225  Hepatocellular carcinoma
pale05226  Gastric cancer
pale05230  Central carbon metabolism in cancer
pale05231  Choline metabolism in cancer
pale05235  PD-L1 expression and PD-1 checkpoint pathway in cancer
pale05417  Lipid and atherosclerosis
Brite
KEGG Orthology (KO) [BR:pale00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    102885950 (NRAS)
   04012 ErbB signaling pathway
    102885950 (NRAS)
   04014 Ras signaling pathway
    102885950 (NRAS)
   04015 Rap1 signaling pathway
    102885950 (NRAS)
   04370 VEGF signaling pathway
    102885950 (NRAS)
   04371 Apelin signaling pathway
    102885950 (NRAS)
   04068 FoxO signaling pathway
    102885950 (NRAS)
   04072 Phospholipase D signaling pathway
    102885950 (NRAS)
   04071 Sphingolipid signaling pathway
    102885950 (NRAS)
   04151 PI3K-Akt signaling pathway
    102885950 (NRAS)
   04150 mTOR signaling pathway
    102885950 (NRAS)
 09140 Cellular Processes
  09141 Transport and catabolism
   04140 Autophagy - animal
    102885950 (NRAS)
   04137 Mitophagy - animal
    102885950 (NRAS)
  09143 Cell growth and death
   04210 Apoptosis
    102885950 (NRAS)
   04218 Cellular senescence
    102885950 (NRAS)
  09144 Cellular community - eukaryotes
   04540 Gap junction
    102885950 (NRAS)
   04550 Signaling pathways regulating pluripotency of stem cells
    102885950 (NRAS)
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    102885950 (NRAS)
 09150 Organismal Systems
  09151 Immune system
   04625 C-type lectin receptor signaling pathway
    102885950 (NRAS)
   04650 Natural killer cell mediated cytotoxicity
    102885950 (NRAS)
   04660 T cell receptor signaling pathway
    102885950 (NRAS)
   04662 B cell receptor signaling pathway
    102885950 (NRAS)
   04664 Fc epsilon RI signaling pathway
    102885950 (NRAS)
   04062 Chemokine signaling pathway
    102885950 (NRAS)
  09152 Endocrine system
   04910 Insulin signaling pathway
    102885950 (NRAS)
   04929 GnRH secretion
    102885950 (NRAS)
   04912 GnRH signaling pathway
    102885950 (NRAS)
   04915 Estrogen signaling pathway
    102885950 (NRAS)
   04917 Prolactin signaling pathway
    102885950 (NRAS)
   04921 Oxytocin signaling pathway
    102885950 (NRAS)
   04926 Relaxin signaling pathway
    102885950 (NRAS)
   04935 Growth hormone synthesis, secretion and action
    102885950 (NRAS)
   04919 Thyroid hormone signaling pathway
    102885950 (NRAS)
   04916 Melanogenesis
    102885950 (NRAS)
  09156 Nervous system
   04725 Cholinergic synapse
    102885950 (NRAS)
   04726 Serotonergic synapse
    102885950 (NRAS)
   04720 Long-term potentiation
    102885950 (NRAS)
   04730 Long-term depression
    102885950 (NRAS)
   04722 Neurotrophin signaling pathway
    102885950 (NRAS)
  09158 Development and regeneration
   04360 Axon guidance
    102885950 (NRAS)
  09149 Aging
   04211 Longevity regulating pathway
    102885950 (NRAS)
   04213 Longevity regulating pathway - multiple species
    102885950 (NRAS)
  09159 Environmental adaptation
   04714 Thermogenesis
    102885950 (NRAS)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    102885950 (NRAS)
   05206 MicroRNAs in cancer
    102885950 (NRAS)
   05205 Proteoglycans in cancer
    102885950 (NRAS)
   05207 Chemical carcinogenesis - receptor activation
    102885950 (NRAS)
   05208 Chemical carcinogenesis - reactive oxygen species
    102885950 (NRAS)
   05203 Viral carcinogenesis
    102885950 (NRAS)
   05230 Central carbon metabolism in cancer
    102885950 (NRAS)
   05231 Choline metabolism in cancer
    102885950 (NRAS)
   05235 PD-L1 expression and PD-1 checkpoint pathway in cancer
    102885950 (NRAS)
  09162 Cancer: specific types
   05210 Colorectal cancer
    102885950 (NRAS)
   05225 Hepatocellular carcinoma
    102885950 (NRAS)
   05226 Gastric cancer
    102885950 (NRAS)
   05214 Glioma
    102885950 (NRAS)
   05216 Thyroid cancer
    102885950 (NRAS)
   05221 Acute myeloid leukemia
    102885950 (NRAS)
   05220 Chronic myeloid leukemia
    102885950 (NRAS)
   05218 Melanoma
    102885950 (NRAS)
   05211 Renal cell carcinoma
    102885950 (NRAS)
   05219 Bladder cancer
    102885950 (NRAS)
   05215 Prostate cancer
    102885950 (NRAS)
   05213 Endometrial cancer
    102885950 (NRAS)
   05224 Breast cancer
    102885950 (NRAS)
   05223 Non-small cell lung cancer
    102885950 (NRAS)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    102885950 (NRAS)
   05170 Human immunodeficiency virus 1 infection
    102885950 (NRAS)
   05161 Hepatitis B
    102885950 (NRAS)
   05160 Hepatitis C
    102885950 (NRAS)
   05163 Human cytomegalovirus infection
    102885950 (NRAS)
   05167 Kaposi sarcoma-associated herpesvirus infection
    102885950 (NRAS)
   05165 Human papillomavirus infection
    102885950 (NRAS)
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    102885950 (NRAS)
   05022 Pathways of neurodegeneration - multiple diseases
    102885950 (NRAS)
  09165 Substance dependence
   05034 Alcoholism
    102885950 (NRAS)
  09166 Cardiovascular disease
   05417 Lipid and atherosclerosis
    102885950 (NRAS)
  09167 Endocrine and metabolic disease
   04933 AGE-RAGE signaling pathway in diabetic complications
    102885950 (NRAS)
  09176 Drug resistance: antineoplastic
   01521 EGFR tyrosine kinase inhibitor resistance
    102885950 (NRAS)
   01522 Endocrine resistance
    102885950 (NRAS)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:pale04131]
    102885950 (NRAS)
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:pale04147]
    102885950 (NRAS)
   04031 GTP-binding proteins [BR:pale04031]
    102885950 (NRAS)
Membrane trafficking [BR:pale04131]
 Exocytosis
  Small GTPases and associated proteins
   Other small GTPases and associated proteins
    102885950 (NRAS)
 Endocytosis
  Macropinocytosis
   Ras GTPases
    102885950 (NRAS)
Exosome [BR:pale04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   102885950 (NRAS)
  Exosomal proteins of other body fluids (saliva and urine)
   102885950 (NRAS)
  Exosomal proteins of breast cancer cells
   102885950 (NRAS)
  Exosomal proteins of colorectal cancer cells
   102885950 (NRAS)
GTP-binding proteins [BR:pale04031]
 Small (monomeric) G-proteins
  Ras Family
   Ras [OT]
    102885950 (NRAS)
SSDB
Motif
Pfam: Ras Roc Arf GTP_EFTU MMR_HSR1 RsgA_GTPase FeoB_N Septin Ldh_1_N
Other DBs
NCBI-GeneID: 102885950
NCBI-ProteinID: XP_006919728
UniProt: L5K2M8
LinkDB
Position
Unknown
AA seq 189 aa
MTEYKLVVVGAGGVGKSALTIQLIQNHFVDEYDPTIEDSYRKQVVIDGETCLLDILDTAG
QEEYSAMRDQYMRTGEGFLCVFAINNSKSFADINLYREQIKRVKDSDDVPMVLVGNKCDL
PTRTVDTKQAHELAKSYGIPFIETSAKTRQGVEDAFYTLVREIRQYRMKKLNSSDDGTQG
CMGLPCVVM
NT seq 570 nt   +upstreamnt  +downstreamnt
atgactgagtacaaactggtggtggttggagcaggtggtgttgggaaaagcgcgctgacc
atccagctaatccagaaccactttgtagatgaatatgatcccaccatagaggattcttac
cgaaaacaggtggtgatagacggtgagacctgtctgttggacatcctggacacagctgga
caggaggagtacagtgccatgagagaccagtacatgaggacaggcgaaggcttcctctgc
gtgtttgccatcaataacagcaagtcatttgcagatattaacctctacagggaacagatt
aagcgagtaaaggactcagatgatgtacctatggtgctagtaggaaacaagtgtgatttg
ccaacaaggacagttgacacaaaacaagcccacgaactggccaagagttatgggattcca
ttcattgaaacctcagccaagaccagacagggtgttgaagatgctttttacacactggta
agagaaatacgtcagtaccgaatgaaaaaacttaacagcagtgatgatgggactcaaggt
tgcatggggttgccttgtgtggtgatgtaa

DBGET integrated database retrieval system