Pteropus alecto (black flying fox): 102885950 Help Entry 102885950         CDS       T02993                                  Symbol NRAS Name (RefSeq) GTPase NRas isoform X2   KO K07828   GTPase NRas Organism pale  Pteropus alecto (black flying fox) Pathway pale01521   EGFR tyrosine kinase inhibitor resistance pale01522   Endocrine resistance pale04010   MAPK signaling pathway pale04012   ErbB signaling pathway pale04014   Ras signaling pathway pale04015   Rap1 signaling pathway pale04062   Chemokine signaling pathway pale04068   FoxO signaling pathway pale04071   Sphingolipid signaling pathway pale04072   Phospholipase D signaling pathway pale04137   Mitophagy - animal pale04140   Autophagy - animal pale04150   mTOR signaling pathway pale04151   PI3K-Akt signaling pathway pale04210   Apoptosis pale04211   Longevity regulating pathway pale04213   Longevity regulating pathway - multiple species pale04218   Cellular senescence pale04360   Axon guidance pale04370   VEGF signaling pathway pale04371   Apelin signaling pathway pale04540   Gap junction pale04550   Signaling pathways regulating pluripotency of stem cells pale04625   C-type lectin receptor signaling pathway pale04650   Natural killer cell mediated cytotoxicity pale04660   T cell receptor signaling pathway pale04662   B cell receptor signaling pathway pale04664   Fc epsilon RI signaling pathway pale04714   Thermogenesis pale04720   Long-term potentiation pale04722   Neurotrophin signaling pathway pale04725   Cholinergic synapse pale04726   Serotonergic synapse pale04730   Long-term depression pale04810   Regulation of actin cytoskeleton pale04910   Insulin signaling pathway pale04912   GnRH signaling pathway pale04915   Estrogen signaling pathway pale04916   Melanogenesis pale04917   Prolactin signaling pathway pale04919   Thyroid hormone signaling pathway pale04921   Oxytocin signaling pathway pale04926   Relaxin signaling pathway pale04929   GnRH secretion pale04933   AGE-RAGE signaling pathway in diabetic complications pale04935   Growth hormone synthesis, secretion and action pale05010   Alzheimer disease pale05022   Pathways of neurodegeneration - multiple diseases pale05034   Alcoholism pale05160   Hepatitis C pale05161   Hepatitis B pale05163   Human cytomegalovirus infection pale05165   Human papillomavirus infection pale05166   Human T-cell leukemia virus 1 infection pale05167   Kaposi sarcoma-associated herpesvirus infection pale05170   Human immunodeficiency virus 1 infection pale05200   Pathways in cancer pale05203   Viral carcinogenesis pale05205   Proteoglycans in cancer pale05206   MicroRNAs in cancer pale05207   Chemical carcinogenesis - receptor activation pale05208   Chemical carcinogenesis - reactive oxygen species pale05210   Colorectal cancer pale05211   Renal cell carcinoma pale05213   Endometrial cancer pale05214   Glioma pale05215   Prostate cancer pale05216   Thyroid cancer pale05218   Melanoma pale05219   Bladder cancer pale05220   Chronic myeloid leukemia pale05221   Acute myeloid leukemia pale05223   Non-small cell lung cancer pale05224   Breast cancer pale05225   Hepatocellular carcinoma pale05226   Gastric cancer pale05230   Central carbon metabolism in cancer pale05231   Choline metabolism in cancer pale05235   PD-L1 expression and PD-1 checkpoint pathway in cancer pale05417   Lipid and atherosclerosis Brite KEGG Orthology (KO) [BR:pale00001]  09130 Environmental Information Processing   09132 Signal transduction    04010 MAPK signaling pathway     102885950 (NRAS)    04012 ErbB signaling pathway     102885950 (NRAS)    04014 Ras signaling pathway     102885950 (NRAS)    04015 Rap1 signaling pathway     102885950 (NRAS)    04370 VEGF signaling pathway     102885950 (NRAS)    04371 Apelin signaling pathway     102885950 (NRAS)    04068 FoxO signaling pathway     102885950 (NRAS)    04072 Phospholipase D signaling pathway     102885950 (NRAS)    04071 Sphingolipid signaling pathway     102885950 (NRAS)    04151 PI3K-Akt signaling pathway     102885950 (NRAS)    04150 mTOR signaling pathway     102885950 (NRAS)  09140 Cellular Processes   09141 Transport and catabolism    04140 Autophagy - animal     102885950 (NRAS)    04137 Mitophagy - animal     102885950 (NRAS)   09143 Cell growth and death    04210 Apoptosis     102885950 (NRAS)    04218 Cellular senescence     102885950 (NRAS)   09144 Cellular community - eukaryotes    04540 Gap junction     102885950 (NRAS)    04550 Signaling pathways regulating pluripotency of stem cells     102885950 (NRAS)   09142 Cell motility    04810 Regulation of actin cytoskeleton     102885950 (NRAS)  09150 Organismal Systems   09151 Immune system    04625 C-type lectin receptor signaling pathway     102885950 (NRAS)    04650 Natural killer cell mediated cytotoxicity     102885950 (NRAS)    04660 T cell receptor signaling pathway     102885950 (NRAS)    04662 B cell receptor signaling pathway     102885950 (NRAS)    04664 Fc epsilon RI signaling pathway     102885950 (NRAS)    04062 Chemokine signaling pathway     102885950 (NRAS)   09152 Endocrine system    04910 Insulin signaling pathway     102885950 (NRAS)    04929 GnRH secretion     102885950 (NRAS)    04912 GnRH signaling pathway     102885950 (NRAS)    04915 Estrogen signaling pathway     102885950 (NRAS)    04917 Prolactin signaling pathway     102885950 (NRAS)    04921 Oxytocin signaling pathway     102885950 (NRAS)    04926 Relaxin signaling pathway     102885950 (NRAS)    04935 Growth hormone synthesis, secretion and action     102885950 (NRAS)    04919 Thyroid hormone signaling pathway     102885950 (NRAS)    04916 Melanogenesis     102885950 (NRAS)   09156 Nervous system    04725 Cholinergic synapse     102885950 (NRAS)    04726 Serotonergic synapse     102885950 (NRAS)    04720 Long-term potentiation     102885950 (NRAS)    04730 Long-term depression     102885950 (NRAS)    04722 Neurotrophin signaling pathway     102885950 (NRAS)   09158 Development and regeneration    04360 Axon guidance     102885950 (NRAS)   09149 Aging    04211 Longevity regulating pathway     102885950 (NRAS)    04213 Longevity regulating pathway - multiple species     102885950 (NRAS)   09159 Environmental adaptation    04714 Thermogenesis     102885950 (NRAS)  09160 Human Diseases   09161 Cancer: overview    05200 Pathways in cancer     102885950 (NRAS)    05206 MicroRNAs in cancer     102885950 (NRAS)    05205 Proteoglycans in cancer     102885950 (NRAS)    05207 Chemical carcinogenesis - receptor activation     102885950 (NRAS)    05208 Chemical carcinogenesis - reactive oxygen species     102885950 (NRAS)    05203 Viral carcinogenesis     102885950 (NRAS)    05230 Central carbon metabolism in cancer     102885950 (NRAS)    05231 Choline metabolism in cancer     102885950 (NRAS)    05235 PD-L1 expression and PD-1 checkpoint pathway in cancer     102885950 (NRAS)   09162 Cancer: specific types    05210 Colorectal cancer     102885950 (NRAS)    05225 Hepatocellular carcinoma     102885950 (NRAS)    05226 Gastric cancer     102885950 (NRAS)    05214 Glioma     102885950 (NRAS)    05216 Thyroid cancer     102885950 (NRAS)    05221 Acute myeloid leukemia     102885950 (NRAS)    05220 Chronic myeloid leukemia     102885950 (NRAS)    05218 Melanoma     102885950 (NRAS)    05211 Renal cell carcinoma     102885950 (NRAS)    05219 Bladder cancer     102885950 (NRAS)    05215 Prostate cancer     102885950 (NRAS)    05213 Endometrial cancer     102885950 (NRAS)    05224 Breast cancer     102885950 (NRAS)    05223 Non-small cell lung cancer     102885950 (NRAS)   09172 Infectious disease: viral    05166 Human T-cell leukemia virus 1 infection     102885950 (NRAS)    05170 Human immunodeficiency virus 1 infection     102885950 (NRAS)    05161 Hepatitis B     102885950 (NRAS)    05160 Hepatitis C     102885950 (NRAS)    05163 Human cytomegalovirus infection     102885950 (NRAS)    05167 Kaposi sarcoma-associated herpesvirus infection     102885950 (NRAS)    05165 Human papillomavirus infection     102885950 (NRAS)   09164 Neurodegenerative disease    05010 Alzheimer disease     102885950 (NRAS)    05022 Pathways of neurodegeneration - multiple diseases     102885950 (NRAS)   09165 Substance dependence    05034 Alcoholism     102885950 (NRAS)   09166 Cardiovascular disease    05417 Lipid and atherosclerosis     102885950 (NRAS)   09167 Endocrine and metabolic disease    04933 AGE-RAGE signaling pathway in diabetic complications     102885950 (NRAS)   09176 Drug resistance: antineoplastic    01521 EGFR tyrosine kinase inhibitor resistance     102885950 (NRAS)    01522 Endocrine resistance     102885950 (NRAS)  09180 Brite Hierarchies   09182 Protein families: genetic information processing    04131 Membrane trafficking [BR:pale04131]     102885950 (NRAS)   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:pale04147]     102885950 (NRAS)    04031 GTP-binding proteins [BR:pale04031]     102885950 (NRAS) Membrane trafficking [BR:pale04131]  Exocytosis   Small GTPases and associated proteins    Other small GTPases and associated proteins     102885950 (NRAS)  Endocytosis   Macropinocytosis    Ras GTPases     102885950 (NRAS) Exosome [BR:pale04147]  Exosomal proteins   Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)    102885950 (NRAS)   Exosomal proteins of other body fluids (saliva and urine)    102885950 (NRAS)   Exosomal proteins of breast cancer cells    102885950 (NRAS)   Exosomal proteins of colorectal cancer cells    102885950 (NRAS) GTP-binding proteins [BR:pale04031]  Small (monomeric) G-proteins   Ras Family    Ras [OT]     102885950 (NRAS) BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  Ras Roc Arf GTP_EFTU MMR_HSR1 RsgA_GTPase FeoB_N Septin Ldh_1_N Motif Other DBs NCBI-GeneID:  102885950 NCBI-ProteinID:  XP_006919728 UniProt:  L5K2M8 LinkDB All DBs Position Unknown AA seq 189 aa AA seqDB search MTEYKLVVVGAGGVGKSALTIQLIQNHFVDEYDPTIEDSYRKQVVIDGETCLLDILDTAG QEEYSAMRDQYMRTGEGFLCVFAINNSKSFADINLYREQIKRVKDSDDVPMVLVGNKCDL PTRTVDTKQAHELAKSYGIPFIETSAKTRQGVEDAFYTLVREIRQYRMKKLNSSDDGTQG CMGLPCVVM NT seq 570 nt NT seq  +upstreamnt  +downstreamnt atgactgagtacaaactggtggtggttggagcaggtggtgttgggaaaagcgcgctgacc atccagctaatccagaaccactttgtagatgaatatgatcccaccatagaggattcttac cgaaaacaggtggtgatagacggtgagacctgtctgttggacatcctggacacagctgga caggaggagtacagtgccatgagagaccagtacatgaggacaggcgaaggcttcctctgc gtgtttgccatcaataacagcaagtcatttgcagatattaacctctacagggaacagatt aagcgagtaaaggactcagatgatgtacctatggtgctagtaggaaacaagtgtgatttg ccaacaaggacagttgacacaaaacaagcccacgaactggccaagagttatgggattcca ttcattgaaacctcagccaagaccagacagggtgttgaagatgctttttacacactggta agagaaatacgtcagtaccgaatgaaaaaacttaacagcagtgatgatgggactcaaggt tgcatggggttgccttgtgtggtgatgtaa

DBGET integrated database retrieval system