Pteropus alecto (black flying fox): 102886479 Help Entry 102886479         CDS       T02993                                  Name (RefSeq) metallothionein-1A   KO K14739   metallothionein 1/2 Organism pale  Pteropus alecto (black flying fox) Pathway pale04978   Mineral absorption Brite KEGG Orthology (KO) [BR:pale00001]  09150 Organismal Systems   09154 Digestive system    04978 Mineral absorption     102886479  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03019 Messenger RNA biogenesis [BR:pale03019]     102886479    03029 Mitochondrial biogenesis [BR:pale03029]     102886479 Messenger RNA biogenesis [BR:pale03019]  Eukaryotic type   mRNA surveillance and transport factors    Factors involved in mRNA localization     Factors that have mRNA localization signals      102886479 Mitochondrial biogenesis [BR:pale03029]  Mitochondrial quality control factors   Regulator of mitochondrial biogenesis    Nuclear respiratory factors     102886479 BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  Metallothio Motif Other DBs NCBI-GeneID:  102886479 NCBI-ProteinID:  XP_006908832 UniProt:  L5KWQ8 LinkDB All DBs Position Unknown AA seq 61 aa AA seqDB search MDPNCSCPTGGSCSCTGSCKCKDCRCTSCKKSCCSCCPVGCARCAQGCVCKGASDKCSCC A NT seq 186 nt NT seq  +upstreamnt  +downstreamnt atggaccccaactgctcctgccccactggtggctcctgcagctgcaccggctcctgtaaa tgcaaagactgcagatgcacctcctgcaagaagagctgctgctcctgctgccccgtgggc tgtgcccggtgcgcccagggctgtgtctgcaagggagcatcggacaagtgcagctgctgt gcgtga

DBGET integrated database retrieval system