Pteropus alecto (black flying fox): 102886929 Help Entry 102886929         CDS       T02993                                  Symbol DYNLT3 Name (RefSeq) dynein light chain Tctex-type 3   KO K10420   dynein light chain Tctex-type 1/3 Organism pale  Pteropus alecto (black flying fox) Pathway pale04814   Motor proteins pale05132   Salmonella infection Brite KEGG Orthology (KO) [BR:pale00001]  09140 Cellular Processes   09142 Cell motility    04814 Motor proteins     102886929 (DYNLT3)  09160 Human Diseases   09171 Infectious disease: bacterial    05132 Salmonella infection     102886929 (DYNLT3)  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    03037 Cilium and associated proteins [BR:pale03037]     102886929 (DYNLT3)    04812 Cytoskeleton proteins [BR:pale04812]     102886929 (DYNLT3) Cilium and associated proteins [BR:pale03037]  Motile cilia and associated proteins   Dynein arm    102886929 (DYNLT3) Cytoskeleton proteins [BR:pale04812]  Eukaryotic cytoskeleton proteins   Microtubules    Tubulin-binding proteins     Dyneins      102886929 (DYNLT3) BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  Tctex-1 Motif Other DBs NCBI-GeneID:  102886929 NCBI-ProteinID:  XP_006918324 UniProt:  L5K707 LinkDB All DBs Position Unknown AA seq 116 aa AA seqDB search MEEYHRHCDEVGFNAEEAHNIVKECIDGVLGGEDYNQNNINQWTASIVEQSLAHLVKLGK AYKYIVTCAVVQRSAYGFHTASSCFWDVTSDGTCTVRWENRTMNCIVNVFAIAIVL NT seq 351 nt NT seq  +upstreamnt  +downstreamnt atggaggagtatcatcgccactgcgacgaggttggcttcaatgcggaggaagcccacaat attgttaaagagtgtatagatggagttttgggtggtgaagattataatcagaacaacatc aaccaatggaccgcaagcatagtggaacaatccttagcacatttggttaagctgggaaaa gcttataaatatattgtgacctgtgcagtggtccagaggagtgcatacggctttcataca gccagctcatgcttttgggatgtcacatctgatggaacctgtaccgtaagatgggagaac cgaaccatgaattgtatcgtcaatgtttttgccattgcaattgtcctgtga

DBGET integrated database retrieval system