Pteropus alecto (black flying fox): 102887611
Help
Entry
102887611 CDS
T02993
Symbol
NDUFB7
Name
(RefSeq) NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 7
KO
K03963
NADH dehydrogenase (ubiquinone) 1 beta subcomplex subunit 7
Organism
pale
Pteropus alecto (black flying fox)
Pathway
pale00190
Oxidative phosphorylation
pale01100
Metabolic pathways
pale04714
Thermogenesis
pale04723
Retrograde endocannabinoid signaling
pale04932
Non-alcoholic fatty liver disease
pale05010
Alzheimer disease
pale05012
Parkinson disease
pale05014
Amyotrophic lateral sclerosis
pale05016
Huntington disease
pale05020
Prion disease
pale05022
Pathways of neurodegeneration - multiple diseases
pale05208
Chemical carcinogenesis - reactive oxygen species
pale05415
Diabetic cardiomyopathy
Module
pale_M00147
NADH dehydrogenase (ubiquinone) 1 beta subcomplex
Brite
KEGG Orthology (KO) [BR:
pale00001
]
09100 Metabolism
09102 Energy metabolism
00190 Oxidative phosphorylation
102887611 (NDUFB7)
09150 Organismal Systems
09156 Nervous system
04723 Retrograde endocannabinoid signaling
102887611 (NDUFB7)
09159 Environmental adaptation
04714 Thermogenesis
102887611 (NDUFB7)
09160 Human Diseases
09161 Cancer: overview
05208 Chemical carcinogenesis - reactive oxygen species
102887611 (NDUFB7)
09164 Neurodegenerative disease
05010 Alzheimer disease
102887611 (NDUFB7)
05012 Parkinson disease
102887611 (NDUFB7)
05014 Amyotrophic lateral sclerosis
102887611 (NDUFB7)
05016 Huntington disease
102887611 (NDUFB7)
05020 Prion disease
102887611 (NDUFB7)
05022 Pathways of neurodegeneration - multiple diseases
102887611 (NDUFB7)
09166 Cardiovascular disease
05415 Diabetic cardiomyopathy
102887611 (NDUFB7)
09167 Endocrine and metabolic disease
04932 Non-alcoholic fatty liver disease
102887611 (NDUFB7)
BRITE hierarchy
SSDB
Ortholog
Paralog
GFIT
Motif
Pfam:
NDUF_B7
Motif
Other DBs
NCBI-GeneID:
102887611
NCBI-ProteinID:
XP_006918826
UniProt:
L5K8E4
LinkDB
All DBs
Position
Unknown
AA seq
137 aa
AA seq
DB search
MGAHLARRYLSDSSGEPDPLRMPTFPPDYGFQGRKEREMVATQQEMNDAQLVLQQRDYCA
HYLIRLLKCKRDSFPNFLACKHEQHDWDYCEHLDYVMRMKEYERERRLLQRKKRREQREA
DLARGQGPGEVAPEVAL
NT seq
414 nt
NT seq
+upstream
nt +downstream
nt
atgggggcgcacttggcccgacgctacctaagcgattcctcaggggagccagaccctctg
cggatgcccaccttcccgcccgactacggcttccaagggcgcaaggagcgcgagatggtg
gccacgcagcaggaaatgaacgacgcacagctggtgctccagcagcgggattactgtgcc
cattacctcatccgactgctcaagtgcaagcgtgacagcttccccaacttcctggcctgc
aagcatgagcagcacgactgggattactgcgagcaccttgactacgtgatgcgcatgaag
gagtatgagcgggagcggcggctgctccagcggaagaagcggagagagcagagggaggca
gacctggccagaggccaggggcccggtgaggtggcccctgaggtggccctgtag
DBGET
integrated database retrieval system